KEGG   Chryseobacterium shandongense: EG350_01815Help
Entry
EG350_01815       CDS       T05920                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
csha  Chryseobacterium shandongense
Pathway
csha00562  Inositol phosphate metabolism
csha00564  Glycerophospholipid metabolism
csha01100  Metabolic pathways
csha01110  Biosynthesis of secondary metabolites
csha02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:csha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EG350_01815
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EG350_01815
   00565 Ether lipid metabolism
    EG350_01815
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EG350_01815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:csha02042]
    EG350_01815
Enzymes [BR:csha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     EG350_01815
Bacterial toxins [BR:csha02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   EG350_01815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AZA56011
UniProt: A0A3G6MJU1
Position
complement(371737..374079)
Genome map
AA seq 780 aa AA seqDB search
MNRREFLEKSGILLAGLGTSSVLHPAILKALMIEPAAQSTFYDAEHVVILMQENRSFDHA
FGSLKGVRGFLDSRAFVKQDGHSVFFQKNNQGKYAAPARLNLRNTKSTWMSSLPHSWGNQ
QQALNTGKYDQWLQAKESGNKNYKDIPLTLGYYNREDLPFYYQLADAFTIFDQYFSSSLT
GTTPNRLFHWSGTLREQKNGKVKANVYNENIDYDKDHQARWKSFPEILEEKNISWRIYQN
EISLPKGMSEEQDAWLGNFTDNPIEWFSKFNVKFSKGYHEYIPNIIASLKKEIEKHPDRK
EKLEKRIAELEEDNVKYHPDQFGKLSQKERNLHEKAFTTNVNDPDYRNLEIRHDENGDRL
VVPKGDVLYQFRNDVENKKLPLVSWLIAPERFSDHPGSPWYGAWYISEVLNILTKDPETW
KKTIFIINYDENDGYFDHVLPFAPPQNPSQPVDLNGVEGVEYVSKKQEYMASPALKDHEK
TEGTIGLGYRVPMIIASPWTKGGFVNSEVSDHTSVLMFLENFIRKKFNKDVTVDNISEWR
RAICGDLTSAFNSSSILIPEMNYLDQKEYAKAINSAKNRPIPYLRWYEESELDSNILDIQ
ERGTRPSNALPYNFHVNLENDKIIMKNLKEKAVPLIIYDRTKFKEDHFYFSYTLYAKQEL
SHIVHSGVYDYEIFGPNGFYRNFKGNNTSELKISLINYPSKNMVEINIEKMQENNTGVII
EDLYEKNYTSRTIHQTEKLKFNLDKTKGWYDLKIISDDNIWHFAGRLETGKPSISDPHWS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagagaatttttggaaaaatctggcattttgctggccggactgggaacttca
agtgttttacatcctgccattctgaaggctctgatgattgagcccgctgcccagtctact
ttttatgatgcggagcatgttgttattcttatgcaggaaaaccgttcgttcgatcatgca
ttcggttctctgaaaggcgtaagaggttttttggacagcagagcttttgtaaaacaggat
ggccactccgttttttttcaaaaaaataatcaaggaaaatatgctgctcctgcacgcctt
aatttaaggaataccaagtctacttggatgagttctctgccccattcatggggtaatcaa
caacaagccctcaatacaggtaaatatgaccagtggcttcaggctaaagaatccggtaat
aaaaactataaggatatccctttaacattaggatattataatcgggaagaccttccgttt
tattatcagctggcagatgcatttacgatctttgatcagtatttcagctcgtcattaaca
ggaaccacgcccaacaggcttttccattggtccggaactttacgtgagcaaaaaaatgga
aaggtaaaggccaatgtctataatgaaaatattgattatgataaagaccatcaggcaagg
tggaagagttttccggaaatcctggaagagaaaaatatctcctggagaatttatcagaac
gaaatcagtcttccaaaaggaatgtcagaagaacaggatgcatggttgggtaattttaca
gataatcctatcgaatggttttcaaagttcaatgtaaaattttcgaaaggctatcatgag
tatattccaaatatcattgcttccctgaaaaaggaaatagaaaaacacccggatcggaaa
gaaaagctggaaaaaagaattgccgagctagaagaagacaatgtaaaatatcatcctgac
caattcggaaaactttcacagaaggaaagaaatcttcatgaaaaagcatttaccaccaat
gttaatgatcctgattaccggaatcttgaaataaggcatgatgaaaacggcgacaggctt
gttgtaccgaaaggtgacgtcctgtaccaattcagaaatgatgttgaaaataagaaactt
ccgttggtatcatggcttattgctcctgaacgcttttcagatcatcccggatctccttgg
tacggtgcgtggtatatttccgaagtgctaaatatcctgacgaaagatcccgaaacctgg
aaaaaaacaatctttattattaactatgatgaaaatgatggctattttgatcatgtcttg
ccttttgccccacctcaaaatccgagccaacctgtagaccttaacggtgtagaaggtgta
gaatacgtcagcaaaaaacaggaatatatggcttcgcccgcgctgaaagatcatgaaaaa
actgaaggaacaataggcttaggctatcgcgtgcctatgattattgcatcgccctggaca
aaaggagggtttgtaaattccgaggtctccgatcatacttctgtgctgatgtttctagaa
aattttatccgtaaaaagtttaataaagatgttactgtagataatatcagcgaatggaga
agagcaatatgcggagatctcacatctgctttcaactcctccagtatacttatcccagag
atgaattatttggatcagaaagaatatgctaaagcgattaattcagctaaaaatagacct
attccctatctaagatggtatgaagaaagtgagctggacagtaatattcttgacattcag
gaacgaggtacaagaccgtccaatgcacttccctataattttcatgtcaatctggagaat
gacaaaatcatcatgaaaaatttaaaggaaaaggctgttccgctcattatatatgataga
acaaaatttaaagaagatcatttctatttttcatatactctatatgcaaaacaagaactt
tcacatatagtacattctggagtctacgactatgaaatattcggtcctaatggtttctac
aggaattttaaaggcaacaacacttctgaactaaaaatatcattgattaattatccctca
aaaaatatggtagaaatcaacatcgaaaagatgcaagaaaataatactggggtaataata
gaagatttgtatgagaaaaattatacaagtagaactatacatcaaactgaaaaattaaag
ttcaatctggataaaactaaaggctggtacgatctgaaaataatttcagatgataatatc
tggcattttgccggccgtttggaaaccggtaaaccttctatctcagatccacactggagt
tga

DBGET integrated database retrieval system