KEGG   Chryseobacterium shandongense: EG350_03110Help
Entry
EG350_03110       CDS       T05920                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
csha  Chryseobacterium shandongense
Pathway
csha00900  Terpenoid backbone biosynthesis
csha01110  Biosynthesis of secondary metabolites
csha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EG350_03110
Enzymes [BR:csha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     EG350_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AZA56246
UniProt: A0A3G6MSC2
Position
658987..660315
Genome map
AA seq 442 aa AA seqDB search
MNHQPVEGFSKLSKQRKIDWLISEYLSNDRSYEQILQQYWNNNAELQKLHEEFSENTISN
FYMPYGIAPNFLIDGKLLALPMAVEESSVVAAASKAAKFWIDKGGFKTTIINTEKLGHTH
FIFNVESHKLLHFFNFRLKKKLFEATEDITANMRKRGGGILDIKLIDKTAEMPNYYQLKA
SFDTVDSMGANFINSCLEQFGKTLKQEVAENEDFTQEEKDSLQIVMNILSNFTPDCIVRA
EVSCKIDDLKDDSGISNEEFAWKFKQAVTIAEIEPFRATTHNKGIMNGVDAVVIATGNDF
RATEACAHAYAARNGKYSSLTHCTTDNGIFRFWIDLPISVGVVGGLTNLHPLVKFSLALL
GKPSAQELMSILAVSGLAQNFGALRSLITTGIQKGHMKMHLLNILNQMGATEEEKQHFVT
YFKDKTVSHHEVIHEFNRLRGQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatcaaccggtagaaggtttttccaaactttccaagcaaagaaaaatcgattgg
ctcatctcagaataccttagtaacgatcgcagttacgaacagattttacaacaatactgg
aataataatgccgaacttcagaaacttcatgaagagttttctgaaaataccatttccaac
ttttatatgccatacggaatagcgccgaatttcctgattgacgggaaattactggctttg
cccatggctgttgaagaaagctcggtagtagcagcagcatccaaagcagcaaaattctgg
attgataaaggaggttttaaaacgaccattatcaataccgaaaaactcggccatacccac
tttatatttaacgtagaatcccataaattattacatttcttcaacttcaggctaaagaaa
aagctttttgaagcgacagaagatattacggcgaatatgcggaaacgcggcggcggaatt
ttagatatcaaattaattgataaaactgctgaaatgccgaattattaccagttgaaggct
agctttgacacggtagattcaatgggagcgaattttatcaattcatgcctggagcaattc
ggaaagacattgaagcaggaagtagcggaaaatgaagattttacccaagaagagaaagac
tcattgcaaattgtgatgaatattctttccaatttcactcccgattgtatcgtaagagct
gaagtttcctgcaagattgatgatctgaaagacgatagcggaatttccaatgaagagttc
gcatggaagttcaagcaagcggtaacgattgctgaaattgaacccttccgtgctacaacg
cataataaaggaattatgaacggggtagatgcggtggttattgctaccggaaacgatttc
cgcgcaacggaagcctgtgcacatgcttatgctgcaaggaacggaaaatattcttcttta
acccattgtacaacagataacggaattttcagattttggatcgatcttccgatttcggta
ggcgttgttggaggtttgacaaatcttcatcccttggtaaagttttctctggctttgtta
ggaaaaccttcagcccaggaattaatgagtatcctggctgtttccggtctggctcagaat
ttcggagcactgcgttctttaatcactaccggaattcagaaaggacatatgaaaatgcat
ttgctgaatatcctaaaccagatgggcgcaacggaagaagaaaagcagcatttcgtaacc
tatttcaaagataaaacagtgagccaccacgaagtgattcatgagtttaacaggttgaga
ggacaataa

DBGET integrated database retrieval system