KEGG   Chryseobacterium shandongense: EG350_05745Help
Entry
EG350_05745       CDS       T05920                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
csha  Chryseobacterium shandongense
Brite
KEGG Orthology (KO) [BR:csha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EG350_05745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AZA56702
UniProt: A0A3G6MLU8
Position
1255482..1256624
Genome map
AA seq 380 aa AA seqDB search
MEFPILLIVIIALALIFDYINGFHDAANSIATIVSTKVLTPFQAVLWAALWNFAAFFIAA
YIIGEFKIGNTIAKTVNENFINLEVIFSGLIAAIAWNLLTWWFGIPSSSSHTLIGGFLGA
ALMHAFMMDYHDVVASSPELGMWDTIKEAASQVTHQSVVKFDKVIPIFLFIFMAPIIGMI
ISIIITLIIVHLYKKSNPHKADQSFKRLQLASSALFSLGHGLNDAQKVMGIIGAALIYYH
VQMLQDPVYLSIPAAGRFDYFAEHYIWVPLVSFIAIALGTMSGGWKIIKTMGTKITKVTS
LEGVSAETAGAITLFITDHFGIPVSTTHTITGSIIGVGLTKRISAVRWGITVSLLWAWVL
TIPISAIVAGITYLVVTFLS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaatttccgattttacttatagttattattgctttggctcttattttcgattacatc
aatggttttcatgatgcggccaattcaattgcgactattgtttctacaaaagttttaaca
cctttccaggctgtactttgggcagcattatggaactttgcggcattttttattgctgct
tatattattggcgaatttaaaatcggtaacacgattgcaaaaaccgtcaatgagaacttt
atcaatcttgaagtaatattttcaggtcttattgcagcaattgcatggaatcttcttact
tggtggtttggtattccttcatcatcttcacacacgctgatcggaggatttttgggagct
gctctaatgcatgcttttatgatggattatcatgatgttgtcgcatcaagcccggaattg
gggatgtgggataccatcaaagaggcggcaagccaggtaacacaccagagtgttgtgaaa
tttgataaggtaattcctattttcttattcattttcatggccccgattatcgggatgatt
atttctatcattatcaccttaattattgttcacctttataaaaaatcgaatccgcataaa
gcagaccagtctttcaaaagattgcagctcgcttcttcagcattgttcagtttaggacac
ggcctgaatgatgctcagaaagtaatgggtatcattggtgctgcattgatctactatcat
gtacagatgttacaggatcccgtttacctctctatacctgctgcaggacgttttgactat
tttgcagagcattatatctgggttcctttagtttcatttattgccattgctttaggaaca
atgagtggtggatggaagatcatcaaaacaatgggtacgaaaatcacaaaagtaacttca
ttagagggtgtaagcgcagaaactgcaggagcaattacattatttattacagatcacttt
gggattcctgtttctacaacacataccattacaggttccatcatcggggttggtcttaca
aaaagaatatctgcggtaagatggggaatcaccgtgagcttgctttgggcatgggttctt
accattccgatctcagcaattgttgcaggaattacgtatcttgtcgtaacatttttgtct
taa

DBGET integrated database retrieval system