KEGG   Chryseobacterium shandongense: EG350_09325Help
Entry
EG350_09325       CDS       T05920                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
csha  Chryseobacterium shandongense
Brite
KEGG Orthology (KO) [BR:csha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EG350_09325 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AZA57369
UniProt: A0A3G6QYE6
Position
2070746..2071135
Genome map
AA seq 129 aa AA seqDB search
MMFSKMTSNIKVSVIPEYDSKNSYPSENRYVFKYNITIENDGSFPIKILKRKWLIFDVGF
GYTEIIGDGVIGLTPEIPVNENFAYFSNVMLRSGVGNMSGKYLVRNMDTQENFEIDIPKF
NLLSEVLSN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcaaaaatgacctctaatatcaaagtttcagtaatacctgaatatgatagc
aaaaacagttatccgtccgaaaacagatatgttttcaagtacaacatcaccatcgaaaat
gatggaagctttcccataaagattttaaagcgaaaatggctgatttttgatgtgggattc
ggctatactgaaatcatcggagacggtgtgattggccttacgccagagattcctgttaac
gaaaattttgcctatttttctaatgttatgcttcgttcaggagttgggaatatgagtgga
aaatatcttgtaagaaacatggatactcaggaaaattttgaaattgatattcctaaattt
aatcttttgtcagaagttttaagtaattag

DBGET integrated database retrieval system