KEGG   Chryseobacterium shandongense: EG350_19025Help
Entry
EG350_19025       CDS       T05920                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
csha  Chryseobacterium shandongense
Brite
KEGG Orthology (KO) [BR:csha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csha03016]
    EG350_19025
Enzymes [BR:csha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     EG350_19025
Transfer RNA biogenesis [BR:csha03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    EG350_19025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF2652
Motif
Other DBs
NCBI-ProteinID: AZA59153
UniProt: A0A3G6N2D8
Position
complement(4208573..4209289)
Genome map
AA seq 238 aa AA seqDB search
MLQILYRDEHLIAINKPSGLLVHKSFYSGEADTYAIQELKKQIGQKVYPVHRLDRKTSGV
LLFTLDKEMLKTMSDVFAARAVEKKYIAILRGWAKEEETIDYDLINENEVKQNAVTRYRR
LQTSEIDLPFLKHQTSRYCLVEATPETGRFHQLRKHFKHILHPILGCRKHGCNKQNKLWL
QTFGINKMTLHAHQLIFNHPNSGEKIIINAAIDDEFKKVGDILNFDLGAYSQHANLSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaattctttatcgcgacgaacatcttattgcgatcaataaacccagcggattg
ctggttcataaatctttttattccggcgaggcagatacctatgccattcaggaactgaaa
aagcagatcgggcagaaagtatatccggtacatcggttggatcggaaaacttcgggtgtt
ttgttatttactttagataaggaaatgctgaaaacaatgagtgatgtttttgcagcaaga
gcagtagagaaaaaatatattgccattctgcgtggttgggcgaaagaagaagaaaccatt
gattatgatctgattaatgaaaatgaagtaaagcaaaatgcagttacgcgctaccgccgt
ttacagacttcggaaatcgatctgccttttcttaaacatcagacttcacggtactgtctg
gttgaagcgactcctgaaacaggaaggtttcatcagttgaggaagcattttaaacatatt
ttacatcccattttagggtgtagaaaacatggctgcaataaacagaataagttgtggctt
cagacttttgggatcaataaaatgacacttcatgcgcatcagttaatattcaatcaccca
aattctggcgaaaaaattataattaatgctgcgatagatgatgaatttaaaaaagtaggc
gacattctgaattttgacttgggtgcttactctcagcatgcaaatttgtcatcctga

DBGET integrated database retrieval system