KEGG   Cronobacter malonaticus CMCC45402: P262_00135Help
Entry
P262_00135        CDS       T02955                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00051  Fructose and mannose metabolism
csi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P262_00135
Enzymes [BR:csi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     P262_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh AfaD 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHB68455
UniProt: V5TUT2
Position
complement(99022..100170)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIGLTFADVNQTVLDALNARHSYQVRVVGEQEQIDTV
SGVDAVNSTSEDVVTLIATVDLVTTAVGPVVLERIAPAIAKGLALRKAQGNERPLNIIAC
ENMVRGTSQLKTHVFNALAEGDKAWVESHIGFVDSAVDRIVPPSASAAHDPLEVTVETFS
EWIVDKTQFKGDLPTIAGMELTDNLMAFVERKLFTLNTGHAITAYLGKQAGHQTIRDAIL
DEKIRLVVRGAMEESGAVLIKRYGFDDAKHAAYIEKILSRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHQNLVLGIAAAMHFRSEDDPQAQELAQLIADKGPQAALAQ
ISGLDANSDVVASAVNAYNATA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatattggtcgtggctttattggcaaactgctc
gctgacgcaggcatcggcctgacgttcgccgacgtgaaccagacggtactggacgcgtta
aacgcgcgtcacagctatcaggtgcgcgtggtgggcgagcaggagcagattgataccgtt
tccggcgtggatgcggttaacagcaccagcgaggatgtcgtgacgcttatcgccacggtc
gatctggtgacgaccgccgttggcccggtggtactggagcgcatcgctccggcgattgcc
aaaggcctggcgctgcgtaaagcgcagggcaacgaacgcccgctcaatatcatcgcctgt
gaaaacatggtgcgcggcaccagccaactgaaaacgcacgtctttaacgcgctcgcagag
ggcgataaagcctgggtggaaagccacatcggttttgttgactccgccgttgaccgtatc
gtgccgccgtcggcatccgccgcgcacgatccgctggaagtcaccgtggaaaccttcagc
gagtggattgtcgataaaacccagttcaaaggcgatttgccgaccattgcaggtatggag
ctgaccgacaatctgatggcatttgttgaacgcaagctcttcaccctgaacaccgggcat
gctataaccgcctacctcggaaaacaggccggccatcagaccattcgcgacgcgattctg
gatgagaaaattcgtctggtggtacgcggcgcgatggaagagagcggcgcggtgctgatt
aagcgctacggctttgatgacgcgaaacatgccgcgtatatcgagaagatccttagccgt
tttgaaaacccgtacctgaaagacgatgtggagcgcgttggccgtcagccgctgcgcaaa
ctgagcgcaggcgaccgtctgatcaagccgctgctgggcacgctggaatatggcctgccg
catcagaatctggtgctgggtatcgccgccgcgatgcatttccgcagcgaagacgatccg
caggcgcaggagctggcgcagcttatcgctgacaaaggcccacaggccgcgctggcgcag
atttccggtctggacgccaacagcgatgtcgtggcttcggcagtaaacgcgtataacgca
acagcgtaa

DBGET integrated database retrieval system