KEGG   Cronobacter malonaticus CMCC45402: P262_01067Help
Entry
P262_01067        CDS       T02955                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00071  Fatty acid degradation
csi00280  Valine, leucine and isoleucine degradation
csi00310  Lysine degradation
csi00362  Benzoate degradation
csi00380  Tryptophan metabolism
csi00620  Pyruvate metabolism
csi00630  Glyoxylate and dicarboxylate metabolism
csi00640  Propanoate metabolism
csi00650  Butanoate metabolism
csi00900  Terpenoid backbone biosynthesis
csi01100  Metabolic pathways
csi01110  Biosynthesis of secondary metabolites
csi01120  Microbial metabolism in diverse environments
csi01130  Biosynthesis of antibiotics
csi01200  Carbon metabolism
csi01212  Fatty acid metabolism
csi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P262_01067
   00630 Glyoxylate and dicarboxylate metabolism
    P262_01067
   00640 Propanoate metabolism
    P262_01067
   00650 Butanoate metabolism
    P262_01067
  Lipid metabolism
   00071 Fatty acid degradation
    P262_01067
   00072 Synthesis and degradation of ketone bodies
    P262_01067
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P262_01067
   00310 Lysine degradation
    P262_01067
   00380 Tryptophan metabolism
    P262_01067
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P262_01067
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P262_01067
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    P262_01067
Enzymes [BR:csi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P262_01067
Exosome [BR:csi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P262_01067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHB69120
UniProt: V5TWS5
Position
785193..786371
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLARTGLDPLDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRSGAQSDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARAAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRANTSAEALARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKREARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtaggggccgcacgcacgcccattggctgctttcagggccag
cttgcgcgtcgctcggcggtggaactcggtgcggtggtcattgaggcgctgctggcgcgc
accggtctcgatccgctggatgtcgatgaagtgatcctgggccaggtgctgaccgcgggt
gcgggccagaacccggcgaggcagaccgcgttgaatagtggcctgccgtggtccgtttcg
gcgattaccatcaacgacgtatgcggctctggactgaaggcgctgcatctggcgacgcag
gcgattcagtgcggagaggcggatgtagtgattgccggcgggcaggagaacatgagccgc
gccccgcatgtgctgaccgaagggcgcagcggtgcgcaaagcgacagtcatatcatcgac
agcctggtgcatgacgggctgtgggacgcgtttaacgattaccacatgggcgtcacggcg
gaaaatctggcgcgtgaatataacatcagccgcgaacatcaggatgcgtacgcgcttgcg
tcgcagcataaggcgcgggcagccatcgacagcggccggtttcgtgacgagatcgtgccg
gtcgtgattgaacagatgcagggcgcgccgctggtggtggataccgacgagcagccgcgc
gctaataccagtgccgaagcgctggcgcgtctgtcgcccgctttcgatcgcctcgggagc
gtcacggcgggaaacgcttcgtcaatgaatgacggcgcggcggcggtgctgatgatgagc
gccagcaaagcacaggagatggggctgccggtgctggcgcgcattcgcgccttcgcaagc
gtgggggtcgatccggcgctgatgggcattgcgccggtctacgccacgcgccgctgtctg
gagcgcgcgggctggcagctcaatgatgttgatcttatcgaggctaatgaggcgttcgcg
gcacagacgctgtcagtcggtaagctactggagtgggacgagcgcaaggtgaatgttaac
ggcggcgcgattgcgctggggcatccgattggcgcgtctggctgccgtattctcgtctct
ctggtgcatgaaatggtaaaacgtgaagctcgcaaagggcttgccacgctatgcatcggt
ggcggacagggcgtggcgctggcgattgagcgcgattaa

DBGET integrated database retrieval system