KEGG   Cronobacter malonaticus CMCC45402: P262_03228Help
Entry
P262_03228        CDS       T02955                                 

Definition
(GenBank) gamma-glutamylputrescine synthetase
  KO
K09470  gamma-glutamylputrescine synthase [EC:6.3.1.11]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00330  Arginine and proline metabolism
csi01100  Metabolic pathways
Module
csi_M00136  GABA biosynthesis, prokaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    P262_03228
Enzymes [BR:csi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.11  glutamate---putrescine ligase
     P262_03228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: AHB70667
UniProt: V5U0J2
Position
complement(2385103..2386521)
Genome map
AA seq 472 aa AA seqDB search
METNIVEVENFVHHSEERRTSAFAREVNAYLERYPLTEYVDVMLTDLNGCFRGKRIPVAG
LLKVEKGCYFPASVFAMDILGNVVEEAGLGQDLGEPDRRCVPVLGSLVPSATDPEYLGQL
LLTMQDEDGTPFDVEPRNVLNRLWQQLRQRGLHPVVAVELEFYLIDRQRDAEGYLQPPCA
PGTQDRNTQSQVYSVDNLDRFADVLSDIDELARMQQIPADGAVAEASPGQFEINLHHTDN
VLQACDHALALKRLVRLVAEKHGMQATFMAKPYEEHAGSGMHIHISIVDDNRQNVLALPD
GEDSDLLKQALAGMIDMMPASMALLAPNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPC
GDRDSHRVEYRVAGADANPYLVMSAVLAGIVHGLENDLPLPEAVEGNGLEQEGTPFPIRQ
SDALYEFQVHPAMRERLGARFCEVFHACKNDELIQFERLITETEIEWMLKNA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaatatcgtggaagtagaaaattttgtgcatcacagtgaagagaggcgaacc
agtgcgtttgcccgcgaagtgaatgcctatcttgagcgttatccgttaacggaatatgtc
gatgtaatgctgacggatctcaacggctgttttcgcggcaaacgcatccctgtggcgggt
cttttaaaagtcgagaaaggctgttatttcccggcctcggtttttgcgatggatattctg
ggcaacgtggtggaagaggcgggactggggcaggatctcggcgagccggaccgccgctgc
gtgccggtcctgggaagcctggtgccgtccgccaccgacccggagtatctcggccagctt
ctgctgaccatgcaggacgaagatggtactccctttgacgttgagccgcgcaacgtgctt
aaccgcctctggcagcagttgcgccagcgcggtctgcaccccgtggtagcggtagagctg
gagttctatctcattgatcgccagcgcgacgccgaaggctatctccagccgccgtgcgcg
cccggcacccaggatcgcaacacccaaagccaggtctattcggtggacaatcttgatcgc
ttcgccgatgtattaagcgatatcgacgagctggcgcgcatgcagcagatccccgccgat
ggcgcggtggcggaagcctcgccaggccagtttgaaatcaacctgcaccataccgataac
gtcttacaggcctgcgatcacgcgctggcgctcaagcgtctcgtgcgcctggtggctgaa
aaacatggcatgcaggccacctttatggccaaaccctatgaagaacacgccggcagcggg
atgcacattcacatcagcattgtcgatgacaacaggcagaacgtgctggcgcttcccgac
ggcgaagattccgacctgcttaagcaggcgctcgccggaatgatcgatatgatgcccgcc
tcgatggcgttgctggcaccaaacgttaactcctaccgccgtttccagccggggatgtat
gtcccgactcaggcctcctggggccataacaaccgcaccgtcgcgctgcgcattccctgc
ggcgatcgcgacagccatcgcgtggaatatcgcgtggcgggcgcggatgcgaacccttat
ctcgtgatgtctgcggtacttgcaggtatagtgcacggcctggaaaacgacttgccgctg
ccagaggcggtggaaggcaacggtctggagcaggaaggaacgccgtttcctatccgccag
agcgacgccctgtatgagttccaggttcatccggcgatgcgcgagcggctgggcgcgcgg
ttttgcgaggtgttccatgcctgcaagaacgacgagcttatccagtttgagcggctcatc
accgaaacggaaattgagtggatgctgaaaaacgcctga

DBGET integrated database retrieval system