KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_00990Help
Entry
CSK29544_00990    CDS       T03903                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00010  Glycolysis / Gluconeogenesis
csj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSK29544_00990
Enzymes [BR:csj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     CSK29544_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P TetR_C_28 SHOCT PerC
Motif
Other DBs
NCBI-ProteinID: AKE93952
UniProt: A0A2S9UGT5
Position
1059548..1060147
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGVWSDYSRVPLANLRQSFSMGEPFHQHERGELSDEDFAKA
LCEEMALPLSFEQFSAGWQAVFVGLRPEVITIMQQLREQGHRVVVLSNTNRLHTTYWPEQ
YPEVRAAADAIYLSQEMGMRKPEPEIYQKVLEQEGFSARDAVFFDDNEANIDGARKVGIT
SVLVTDRKTVPSYFSNPAC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtcattgtagatatcgactttaaccgcgtgctg
ggcgtctggagtgattacagccgcgtgccgctggcgaatctgcgccagagtttctccatg
ggcgagccgtttcatcagcacgagcgtggcgagctgagcgacgaggatttcgcgaaggcg
ctatgcgaagaaatggcgttgccgctgagctttgagcagttctccgcgggctggcaggcg
gtgtttgtcgggttgcgcccggaagtgattactatcatgcagcaactgcgcgagcagggg
catcgtgtggtggtgctctccaacaccaaccggctgcatacgacatactggccggaacag
tacccggaagtgcgggctgccgccgacgctatctatctttcgcaggagatggggatgcgc
aagccggagccggaaatctaccagaaagtgctggagcaggaaggctttagcgcccgcgac
gccgtgtttttcgatgataacgaggcgaatatcgacggcgcgcgcaaagtgggcattacc
agcgtgctggtgactgaccgtaaaactgtgcccagctatttctcgaatcccgcatgttaa

DBGET integrated database retrieval system