KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_01707Help
Entry
CSK29544_01707    CDS       T03903                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00071  Fatty acid degradation
csj00280  Valine, leucine and isoleucine degradation
csj00310  Lysine degradation
csj00362  Benzoate degradation
csj00380  Tryptophan metabolism
csj00620  Pyruvate metabolism
csj00630  Glyoxylate and dicarboxylate metabolism
csj00640  Propanoate metabolism
csj00650  Butanoate metabolism
csj00900  Terpenoid backbone biosynthesis
csj01100  Metabolic pathways
csj01110  Biosynthesis of secondary metabolites
csj01120  Microbial metabolism in diverse environments
csj01130  Biosynthesis of antibiotics
csj01200  Carbon metabolism
csj01212  Fatty acid metabolism
csj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSK29544_01707
   00630 Glyoxylate and dicarboxylate metabolism
    CSK29544_01707
   00640 Propanoate metabolism
    CSK29544_01707
   00650 Butanoate metabolism
    CSK29544_01707
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSK29544_01707
   00072 Synthesis and degradation of ketone bodies
    CSK29544_01707
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSK29544_01707
   00310 Lysine degradation
    CSK29544_01707
   00380 Tryptophan metabolism
    CSK29544_01707
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CSK29544_01707
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSK29544_01707
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSK29544_01707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csj04147]
    CSK29544_01707
Enzymes [BR:csj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CSK29544_01707
Exosome [BR:csj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSK29544_01707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C DUF840
Motif
Other DBs
NCBI-ProteinID: AKE94666
UniProt: A0A0F6VSB5
Position
1791930..1793108
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLTRRSAVELGAVVIEALLTRTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTGGPGDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARVAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRADTSAEGLARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRQARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtcggggctgctcgcacgcccattggctgctttcagggccag
cttacgcgtcgctcggcggtcgagctcggcgcggtggtcattgaggcactgctgacgcgc
accgggcttaaccctcaggatgtcgatgaggttatcctgggccaggtgctgacggcaggc
gcaggccagaatccggcgcggcagactgcgctcaacagcggcctgccgtggtcggtttcg
gcgattaccatcaatgatgtgtgcggctctggcctgaaggcgctgcatctggcgacgcag
gcgatccagtgcggtgaggcggatgtggtgattgctggcggtcaggaaaatatgagccgc
gcgccgcatgtgctgaccgaagggcgcaccggcgggcccggcgacagccatattatcgac
agcctggtgcatgatgggttgtgggatgcgtttaacgattaccatatgggcgtcacggcg
gaaaatctggcgcgcgaatataacatcagccgtgaacatcaggatgcttacgcgcttgca
tcacagcataaagcgcgggtcgctatcgacagcggacgctttcgtgacgaaatcgtgccc
gtcgtgatcgaacagatgcagggcgcgccgttggtggtcgataccgacgagcagccacgc
gccgataccagcgcggaagggctggcgcgcctgtcgcccgcctttgaccggctgggaagc
gttactgcgggcaacgcctcgtcaatgaatgatggcgcggcggcggtgctgatgatgagc
gccagcaaggcgcaggaaatggggctgccggtgctcgcgcgcatacgcgctttcgcaagc
gtgggcgttgatccggctctgatgggcatcgcgccggtctacgctacgcggcgctgtctg
gagcgcgcgggctggcagctcaatgatgtcgatcttatcgaggccaatgaggcattcgcg
gcacagacgttgtcggtcggtaagctactggagtgggacgagcgcaaggtgaacgttaac
ggcggtgcgattgccctgggacatccgattggcgcgtccggctgccgcattctggtttct
ctggtccatgagatggtgaagcgtcaggctcgcaaagggctcgccacgctttgcattggt
ggcggccagggcgtggcgttggcgattgaacgcgattaa

DBGET integrated database retrieval system