KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_02436Help
Entry
CSK29544_02436    CDS       T03903                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00450  Selenocompound metabolism
csj00970  Aminoacyl-tRNA biosynthesis
csj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CSK29544_02436
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSK29544_02436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csj01007]
    CSK29544_02436
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csj03016]
    CSK29544_02436
Enzymes [BR:csj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CSK29544_02436
Amino acid related enzymes [BR:csj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CSK29544_02436
Transfer RNA biogenesis [BR:csj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CSK29544_02436
 Prokaryotic type
   Other AARSs
    CSK29544_02436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AKE95393
UniProt: A0A2S9UA50
Position
complement(2513134..2515167)
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIAEMSKEHQTDFAGFNISYDNYHSTHSDENRVLSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTVSFDEYWKKDSDAELYHFIGKDIVY
FHSLFWPAMLEGSGFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
AAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFIAKRFDGELAAELADPALYQ
TFTDAAAVIGEAWESREFGKAIREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPELCARAEAFLNVELTWDGVNAPLLGHKVNSFKALYNRIEMKQV
EALVEASKEEVKAAAAPATGELADNPIQETITFDDFAKIDLRVALIENAEFVDGSDKLLR
LTLDLDGEKRNVFSGIRSAYPDPQALIGRLTVMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDSGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaaaaaaattctggtaacgtgcgcgctgccgtacgccaacggctcc
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggttaatttcatctgcgccgacgacgcccacggcacgcctatcatg
ctcaaggcccagcagcttggcattacgccggagcagatgattgccgagatgagcaaagag
catcagaccgattttgcgggctttaacatcagctatgacaactatcactctacgcacagc
gacgaaaaccgcgtgctgtcggagctgatttatactcgcctcaaagaaaacggctttatt
aaaaaccgtaccatttcgcagctctacgacccggaaaaaggcatgttcctgccggaccgt
tttgtaaaaggcacctgcccgaaatgtaaatccccggatcagtacggcgataactgcgaa
gtctgcggcgcgacctacagcccgacggagcttatcgagccgaaatcggtcgtttccggc
gccacgccggtgatgcgtgattctgaacacttcttcttcgatctgccgtcgttcagcgaa
atgctgcaggcgtggacccgctccggcgcgctccaggagcaggtggcgaacaaaatgcag
gagtggtttgaatccggcctgcagcagtgggatatctcccgcgacgcgccctacttcggt
tttgaaatcccgaacgcgccgggcaaatatttttacgtctggctggatgcgcctatcggc
tacatgggctcgttcaaaaatctgtgcgacaagcgcggcgataccgtgagctttgacgag
tactggaaaaaggattctgacgccgagctgtatcactttatcggtaaagatatcgtctac
ttccacagcctgttctggcctgcaatgctcgaaggcagcggtttccgtaaaccgaccaac
ctgtttgtccacggctacgtgacggtcaacggcgcgaaaatgtctaaatcgcgcggcacg
ttcatcaaggccagcacctggctgaaccatttcgacgccgacagcctgcgctactactac
gcggcgaagctctcctcccgcatcgacgatatcgacctgaatctggaagatttcgtgcag
cgcgtgaacgccgacatcgtcaacaaagtggtcaacctggcgtcgcgcaacgcgggcttt
atcgccaaacgttttgacggtgaattagccgctgaactggctgatccggcgctctaccag
accttcaccgacgcggctgccgtgattggcgaggcgtgggagagccgtgagtttggtaag
gctatccgcgaaatcatggcgcttgctgacctcgcgaaccgctacgtggatgagcaggca
ccgtgggtagttgccaaacaggaaggccgcgacgccgatctgcaggcgatttgctctatg
ggtatcaacctgttccgcgtgctgatgacctacctgaagccggtactgccggagctgtgc
gcccgtgccgaagcgttcctgaatgtcgagctgacctgggatggcgttaacgccccgctg
ctcggccataaagtgaacagctttaaagcactctataaccgtattgagatgaaacaagtg
gaggcgttagtggaagcatccaaagaagaagtgaaagcggcggcggcacctgcgactggc
gagctggcggacaacccgatccaggaaaccatcacgtttgacgatttcgcgaaaatcgac
ctgcgcgtggcgctgattgaaaacgcggaatttgtggacggctctgacaaactgctgcgc
ctgacgctggatctggacggcgaaaaacgtaacgtcttctccggcatccgctccgcctac
ccggacccgcaagcgctgattggccgcctgaccgttatggtggcgaacctcgcgccgcgt
aaaatgcgtttcggtatctcagaaggcatggtgatggccgcgggccctggcgggaaagat
atcttcctgttaagcccggacagcggcgcgaagccgggccagcaggtgaaataa

DBGET integrated database retrieval system