KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_03773Help
Entry
CSK29544_03773    CDS       T03903                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00260  Glycine, serine and threonine metabolism
csj01100  Metabolic pathways
csj01110  Biosynthesis of secondary metabolites
csj01120  Microbial metabolism in diverse environments
csj01130  Biosynthesis of antibiotics
csj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSK29544_03773
Enzymes [BR:csj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CSK29544_03773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKE96718
UniProt: A0A384F8B3
Position
3894936..3895943
Genome map
AA seq 335 aa AA seqDB search
MIDLRSDTVTRPGKAMLERMMAAPTGDDVYGDDPTVNALQDYAARLSGKEAALFLPTGTL
ANLVALLSHCERGEEYIVGQLAHNYLYEAGGAAVLGSIQPQPIEADGDGTLPLDKVAAKI
KPDDIHFARTRLLSLENTHNGKVLPRDYLQQAWDFTRERGLALHVDGARIFNAVVAYGCE
LKEIAQYCDTFTICLSKGLGAPVGSLLVGSHDYIKRAKRWRKMTGGGMRQAGILAAAGLY
ALEHNVARLKEDHDNAAWLAAALRDAGAEVRRHDTNMLFVSVPQAQVAALGAFMKSRNVL
ISAAPVTRLVTHLDVNREQLETVVAYWREFLQQTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagcgataccgtcacgcgcccgggcaaagcgatgctggagcgcatg
atggcggcccccaccggggatgatgtttatggcgacgacccaaccgtcaacgcgcttcag
gactatgccgcgcgtttaagcggtaaagaggcggcgctgtttctgccaacaggcaccctg
gccaacctggtggcgctgctgagccactgcgagcgcggcgaggagtatatcgtcggccag
ctcgcgcataattatctgtatgaagcaggcggcgcggcggtgctcggcagcattcagccg
cagccgattgaggccgacggtgacggtacgctgccgctggacaaagtggcggccaaaatc
aaacccgacgacattcatttcgcccgcacccgactgctgagcctggagaatacccataac
ggcaaagtgctgccgcgtgactatctccagcaggcgtgggacttcacccgcgagcgcggt
ctcgcgctgcacgtggatggcgcgcgcatctttaacgcggtggtggcgtatggctgcgag
ctgaaagagatcgcgcagtattgcgacaccttcactatctgcctctcgaaagggcttggc
gcgccggtgggctcgctgctggtcggcagccatgactatattaagcgcgcgaaacgctgg
cggaaaatgaccggcggcggtatgcgtcaggcaggtattctcgccgcagccggcctgtat
gcgctggagcataacgtcgcgcgtctgaaagaggaccacgacaacgcggcctggcttgcc
gcggcgctgcgcgacgcgggtgcagaagtgcgccgtcacgacaccaatatgctgtttgtc
agcgtgccgcaggcgcaggtcgccgcgctgggcgcgtttatgaaatcgcgcaatgtgctg
attagcgccgcgccggtgacgcgtctggtgacgcaccttgatgtcaaccgcgagcagctt
gaaaccgtcgtggcgtactggcgggaatttttacagcaaacggcataa

DBGET integrated database retrieval system