KEGG   Cronobacter sakazakii ES15: ES15_0240Help
Entry
ES15_0240         CDS       T02119                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00500  Starch and sucrose metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES15_0240 (glgB)
Enzymes [BR:csk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ES15_0240 (glgB)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ES15_0240 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AFJ97813
Position
264426..266621
Genome map
AA seq 731 aa AA seqDB search
MSDRVSRDVINALIAGHFSDPFSVLGMHTTDAGIEVRALLPDATEVWVIEPKTGRKVGKL
ECLDSRGFFSGVMPRRKNPFRYQLAVVWHGQQNLIDDPYRFGPLLQELDVWLLSEGTHLR
PYETLGAHPDTMDGVTGTRFSVWAPNAQRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGHLRMKSDPYAFEAQMRPDTASLICGLPEKVEPNTARQDANRFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLIPYVKWMGFTHIELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREEFRYFINAAHAAGLNVILDWVPGHFPSDDFALANFDGTALYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWTERFGIDALRVDAVASMIYRDYSRKEG
EWIPNQYGGRENLEAMEFLRNTNRIIGEQVNGAVTMAEESTDFPGVSRPPESGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHHKMTFGMIYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYAWMWGFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGDDNWHHGVQ
RLVRDLNSTYRHHKALHELDFDPYGFEWLVVEDNQNSVFIFVRRDSQGNEIIVASNFTPV
VRHNYRFGINQPGEWREILNTDSQHYHGSNAGNGGKVRSEAIASHGRDNSLSLTLPPLAT
IWLVREADDAA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgtgtctcaagagacgtgattaatgcgctgattgcgggccatttttcggat
cctttctccgttctgggcatgcacaccaccgacgccgggatcgaagtccgtgcgctgctt
cccgacgctactgaagtctgggtcatcgaacccaagaccgggcgtaaagtgggcaagctt
gagtgtctggattctcgcggttttttcagcggcgtgatgccgcgtcgtaaaaatcctttt
cgctatcaactggccgtggtctggcacgggcagcaaaatctgattgatgacccgtatcgc
ttcggaccgctgcttcaggagctggatgtctggctgctttccgaaggcacgcatttacgt
ccttatgaaacgctcggcgcgcacccggatacgatggacggcgtcaccggcacgcgcttt
tccgtctgggcacccaacgcgcagcgtgtctccgtggtggggcagttcaactactgggat
ggccgccgccacccgatgcgtctgcgtaaagagagcggcatctgggaactcttcatcccc
ggcgcgcacaacggtcagctctacaaatatgaaatgatcgacgcgaacggccatttgcgc
atgaaatccgacccgtatgcgtttgaggcgcagatgcgcccggataccgcgtcgcttatc
tgcggcctgccggaaaaagtcgagccgaacacggcgcgtcaggacgctaaccgcttcgat
gcgccgatctcgatttacgaagtgcatctgggttcatggcgtcgtcataccgacaacaat
ttctggctgagctaccgcgagctggctgaccagctgatcccgtatgtaaagtggatgggc
tttacccatatcgaactgttgccagttaacgaacacccgttcgacggcagctggggctat
cagccgaccgggctgtacgcgccgacgcgccgtttcggcacgcgcgaagagtttcgctat
ttcatcaacgccgcgcacgccgcggggctgaacgttattctcgactgggtgccgggccac
ttcccgtccgatgatttcgcgctggcgaattttgacggcacggcgctctatgagcacagc
gacccgcgtgaaggctatcaccaggactggaacacgcttatctacaactatggccgccgc
gaagtgagcaacttcctggtgggcaacgcgctctactggacggagcgtttcggtatcgac
gcgctgcgtgtggacgccgtcgcctcaatgatttatcgcgactacagccgcaaagaaggc
gagtggatcccgaaccagtacggcgggcgcgaaaacctggaggcgatggagtttctgcgc
aataccaaccgcattatcggcgagcaggtcaacggcgcggtgacgatggcggaagagtcc
accgatttccctggcgtctcacggccgccggaatcgggcgggcttggtttctggtacaag
tggaacctgggctggatgcacgacacgctcgactacatgaagctcgatccggtctatcgc
cagtaccatcaccacaaaatgaccttcgggatgatttacaactacaccgaaaactttgtc
ctgccgctgtcgcatgacgaagtggtgcatggcaaaaaatcgattctcgatcgtatgccc
ggcgacgcctggcagaaattcgccaacctgcgcgcctactacgcgtggatgtggggcttc
ccgggtaaaaaactgctgttcatgggcaacgagtttgcgcaggggcgcgagtggaaccac
gacgccagcctcgactggcatctgctggaaggcgacgacaactggcaccacggcgtgcaa
agactggtgcgcgatctcaattccacgtatcgccaccataaagcgctgcatgaacttgat
ttcgatccttatggctttgaatggttagtggtagaggataaccaaaactcggtatttatc
ttcgtgcgtcgcgattcgcagggcaatgaaatcattgtcgccagtaacttcacgccggtg
gtgcgccataactatcgctttggcattaaccagccgggcgagtggcgcgaaatcctgaat
acggattcgcagcactatcatggcagcaacgccgggaacggcggcaaggtgcgcagcgag
gccatcgccagccacgggcgtgacaattcgctctccctgacgctgccgccgcttgccact
atctggctggtcagagaggcagatgatgcagcttaa

DBGET integrated database retrieval system