KEGG   Cronobacter sakazakii ES15: ES15_1166Help
Entry
ES15_1166         CDS       T02119                                 

Gene name
hisP
Definition
(GenBank) histidine/lysine/arginine/ornithine transporter subunit HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ES15_1166 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csk02000]
    ES15_1166 (hisP)
Enzymes [BR:csk01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ES15_1166 (hisP)
Transporters [BR:csk02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    ES15_1166 (hisP)
   Histidine transporter
    ES15_1166 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_33 G-alpha PRK AAA_23 AAA_24 DUF87 RsgA_GTPase NACHT FtsK_SpoIIIE Mg_chelatase AAA_22
Motif
Other DBs
NCBI-ProteinID: AFJ98739
Position
1246922..1247695
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVTDLHKRYGEHEVLKGVSLKANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVNNQNITLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPVQV
LGLSKQDARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGKIEEEGPPDALF
NNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaataaattaaacgttaccgatctgcacaagcgctacggcgaacatgaagtg
cttaaaggggtatcgctgaaggcgaacgccggtgatgtcatcagcattatcggctcttct
ggctccggcaagagcaccttcctgcgttgcattaactttctggaaaaacccagcgaaggc
accatcgtggtgaacaaccagaacattacgctggtgcgtgacaaggacggtcagctcaag
gtggcggataaaaaccagctgcgccttctgcgcacgcgcctgacgatggtgttccagcac
tttaacctgtggagtcacatgacggtgctggagaacgtgatggaagcgccggttcaggtg
ctgggcttaagcaaacaggatgcgcgcgagcgggcggtgaaatacctcgccaaagtgggc
atcgatgagcgcgcgcagggcaaatacccggtgcatctctccggtggtcagcagcagcgc
gtgtctattgcccgcgcgctggcgatggagccggatgtcttgctgttcgacgaaccgact
tccgcgctggacccggaactggtgggcgaagtgctgcgcattatgcagaagctcgccgaa
gagggcaaaacgatggtggtggtgacgcacgaaatggagtttgcccgccacgtttcctcg
catgtgattttcctgcatcagggcaaaatcgaagaagaagggccgccagacgcgctcttt
aacaacccgcaaagcccgcgtctgcagcagtttttgaagggatcgctgaagtaa

DBGET integrated database retrieval system