KEGG   Cronobacter sakazakii ES15: ES15_1407Help
Entry
ES15_1407         CDS       T02119                                 

Gene name
manC
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00051  Fructose and mannose metabolism
csk00520  Amino sugar and nucleotide sugar metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ES15_1407 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    ES15_1407 (manC)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ES15_1407 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFJ98980
Position
1506630..1508072
Genome map
AA seq 480 aa AA seqDB search
MSQSKLFPVIMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTVCRLNGVQCESPVVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRNSPDTDPLMLVLAADH
VIQDEDAFRNAVRAAMPFAESGKLVTFGIVPNLPETGYGYIRRGEVSNPDVAVDAVAFSV
AQFVEKPDLETAQSYVNSGEYYWNSGMFLFRAGRYLEELAKFRPDILDACEKAMSTVDPD
LDFIRVDEEAFLACPEESIDYAVMEKTADAVVVPMDAGWSDVGSWSSLWEISNHSPEGNV
HHGDVISHNTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRNHVQDVKKVVEKIKAD
GRHEHHIHREVYRPWGKYDSIDQGERYQVKRITVKPGEGLSLQMHHHRAEHWIVVAGTAK
VTINDEVKLVGENESVYIPLGATHCLENPGKIPLDLIEVRSGTYLEEDDVIRFADRYGRV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcaaaactctttccggtaattatggcaggcggctccggcagccgtctgtgg
ccgctttcccgcgtgctttacccaaaacagttcctctgcctgaaaggggatctgacaatg
cttcagaccaccgtctgccgcttaaacggcgtgcagtgcgaaagcccggtggttatctgt
aacgaacagcatcgctttatcgtcgccgagcagctgcgccagctcaacaagctgaccgaa
aacatcatcctggagcctgccgggcgcaacaccgcgccggctatcgcgctggcggcgctg
gcggcgaaacgcaacagcccggacaccgatccgctgatgctggtgctggccgctgaccat
gtcattcaggacgaagacgcgtttcgcaacgccgtgcgcgccgcgatgccgtttgccgaa
agcggcaagctggtcaccttcggcatcgtgccgaacctgccggaaaccggctatggctac
attcgccgtggcgaagtctctaacccggacgtggcggtggacgccgttgccttcagcgtc
gctcagttcgtcgaaaaaccggatctggagaccgcgcagtcctacgtcaacagcggcgaa
tactactggaacagcggcatgttcctgttccgcgccggtcgctacctggaagaactcgcg
aaattccgtccggatattctggacgcctgcgaaaaagccatgagcaccgttgacccggat
ctcgattttatccgcgttgatgaagaagcgttcctggcctgcccggaagagtctatcgac
tacgcggtgatggaaaaaaccgccgacgcggtggtagtgccgatggacgcgggctggagc
gatgtcggctcctggtcgtcgctgtgggaaatttccaaccattcgccggaaggcaacgtg
catcacggcgacgtgatttcgcacaacaccgaaaacagctacgtctatgccgagtctggt
cttgtgaccaccgtcggcgtgaaagaccttgtggtggtacagaccaaagacgccgtgctg
atcgccgaccgtaaccacgtccaggacgtgaaaaaagtggttgaaaaaatcaaagccgat
ggccgccatgaacatcacattcaccgcgaagtgtaccgtccgtggggcaaatatgactcc
atcgatcagggcgaacgctaccaggtgaagcgcatcaccgtgaaaccgggcgaagggctg
tcgttgcagatgcatcatcaccgcgccgagcactggattgtggtggcgggtaccgcgaag
gtgactattaacgacgaggtgaaactggtgggggaaaacgaatcggtttacatcccgctc
ggtgccacgcactgcctggaaaaccccggcaagatcccgctcgacctgattgaagtgcgc
tccggcacttatctggaagaggacgatgtgatccgcttcgccgaccgttacggccgggtg
tga

DBGET integrated database retrieval system