KEGG   Cronobacter sakazakii ES15: ES15_1885Help
Entry
ES15_1885         CDS       T02119                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00620  Pyruvate metabolism
csk00630  Glyoxylate and dicarboxylate metabolism
csk01100  Metabolic pathways
csk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ES15_1885 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    ES15_1885 (aldA)
Enzymes [BR:csk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ES15_1885 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     ES15_1885 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AFJ99458
Position
2009241..2010680
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFVQWQGEAWIDVVNPATEALISRIPDGTAEDARRAIDAAARAQAGW
EALPAIERAGWLRKIAAGIREKAAEISALIVAEGGKTQQLASVEVSFTADYIDYMAEWAR
RYEGEILQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKMAPAMITGNTIVIKPSEF
TPNNAIAFAQIVHDVGLPAGVFNLVLGRGETVGQELAGNPKVALVSMTGSVGAGEKIMMA
AAKNITKVCLELGGKAPAIVMDDADVSLAVKAIVDSRVINSGQVCNCAERVYVQKGIYDR
FVSALGEALSAVKFGDPAARDDIAMGPLINAAALARVKEKVARAVSEGATVALGGKAVEG
KGYFYPPTLLVDVRQEMSIMHEETFGPVLPVVTFDTLEEAIAMANDSEYGLTSSIYTQSL
ATAMKAINGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgtacaacatccgatgtatatcgacggtcagttcgttcagtggcagggc
gaggcgtggatcgatgtcgtgaatcccgccacagaggcgctgatttcccgtatcccggac
ggaacggcagaggacgcgcgccgcgccattgacgccgccgcccgcgcacaggcgggctgg
gaggcgttgcccgccatcgagcgcgccggatggctgcgtaaaatcgccgccggcatccgc
gaaaaggcggcggaaatcagcgcgctgattgtggcggaaggcggcaaaacgcagcagctc
gcgagcgttgaagtcagcttcacggcggattacatcgactatatggccgaatgggcgcgc
cgttatgaaggcgaaatcctgcaaagcgaccggccgggcgaaaatattctggtgtttaag
cgcgcgctcggcgttaccaccggcattctgccgtggaatttcccgttcttcctgatcgcc
cgcaaaatggcccctgcgatgattaccggcaataccattgtgattaaaccgagcgaattc
acgccgaataacgctatcgcgtttgcgcagattgttcatgacgtgggcctgcccgcgggc
gtgtttaacttggtcctggggcgcggcgaaaccgtcgggcaggagctggccggtaacccg
aaagtggcgctggtgagtatgaccggcagcgtcggcgcgggtgagaaaatcatgatggcg
gctgcgaaaaacatcaccaaagtctgccttgagcttggcggcaaagcgcccgccattgtg
atggacgatgcggatgtgtcgcttgcggtaaaagcgattgttgattcgcgcgtgattaac
tccggtcaggtctgtaactgcgccgagcgcgtttatgtgcaaaagggcatttatgaccgt
tttgtcagcgcgcttggcgaggcgctgagcgcggtgaaatttggcgatccggcagcgcgt
gatgatatcgcgatggggccgctgattaacgcggcagcgctggcgcgcgtgaaagaaaaa
gtggcgcgcgcggtcagcgagggcgcgacggtggcgctcggcggcaaggcggtggagggc
aaaggctatttttacccgccgacgctgttggtggatgtgcgccaggagatgagcatcatg
catgaagagacgttcggcccggtgctgccggtcgtcacgttcgatacgctggaagaggcc
attgcgatggcgaatgacagcgaatatggcctgacgtcgtcgatttacacgcagtcgctc
gccaccgcgatgaaagcgattaacgggctgaagtttggcgaaacttacatcaaccgtgaa
aacttcgaagcgatgcaggggttccacgcgggctggcgtaaatccgggatcggcggggcg
gatggcaaacacgggctgcatgaatatctgcaaacccaggttgtctatctgcaaagctaa

DBGET integrated database retrieval system