KEGG   Cronobacter sakazakii ES15: ES15_2186
Entry
ES15_2186         CDS       T02119                                 

Gene name
vasB
Definition
(GenBank) putative type VI secretion system core protein VasB
  KO
K11895  type VI secretion system protein ImpH
Organism
csk  Cronobacter sakazakii ES15
Brite
KEGG Orthology (KO) [BR:csk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_2186 (vasB)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_2186 (vasB)
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AFJ99759
Position
complement(2326850..2327932)
AA seq 360 aa
MAREPQPAHTGLTQQLGEEIWRVNFYRFCQLLEQEHPDHPLLGSTSYPENDPVRFRSWPG
MGFPASELRRVETDDEHPGSPPAVRTTFLGMYGVDSPLPGNYLDDIAQRREGQEAVSSFL
DIFGHRIATQYYRIWRKYAYPATFEPGGTDATSQCLLGLVGLGIPGTAEHIATPVSRFLA
LLGAMRLPTRNAEGIRALVTLLAPDTRAEIHERDPVKVRVTNRSGLGGGERVRLAQRATL
GKMARDANSRVLITLFTRNPQEAAGWLPGGQLHTDLLALMRVYLGYRSDARLRLTVPVHL
LPEPKLAKHRRIQLGRTGLLGLKGGKLSDNRQCITVSLGCYESLSCTVLPLAAEGSYRFD
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgcgagaaccacagccagcacataccgggctgacgcagcaattaggcgaggagatc
tggcgcgttaatttctatcgcttctgccagttgcttgagcaggaacatcctgaccatccg
ctcctgggaagcaccagctaccctgaaaatgatccggtgcggtttcgctcttggccgggc
atgggatttccggccagtgaattacgccgcgtggaaacggatgacgaacaccccggctcc
ccgcccgcggtacgcactacgtttctcggcatgtacggcgtcgactcgccgctaccgggc
aactatctggatgatatcgcccagcggcgcgaagggcaggaagccgtatcctcgtttctg
gatatcttcggccaccgtatcgccacacagtattaccgcatctggcggaaatatgcgtac
ccggccacgtttgagcccggcgggacagatgccacttctcaatgcctgctagggctggtc
ggacttggcattcccggcacggcagaacatatcgctacccccgtttcgcgttttctcgcg
ctgctcggcgccatgcgcttaccgacgcgaaatgctgagggaatacgcgcgctggtgact
ctgctggcaccagacacacgggcagagatccatgagcgcgatcctgtaaaagtgcgggtg
acaaaccgcagcgggctggggggaggcgaacgagtacgtttagcgcagcgtgcgacactc
ggaaaaatggcgcgtgatgcaaacagtcgggtgctcattacattattcacccgcaatccg
caggaggctgcaggctggctgccgggcgggcaattgcatactgatttgctggcgctgatg
cgggtttatctcggctatcgcagtgacgcacggcttcgcctgacagtgccggtacattta
ctccctgaaccaaagcttgcgaaacatcggcgcattcagcttggccgcacaggcctgctg
ggtttgaaaggcggcaaactcagcgataaccgccagtgcatcacggtcagcctgggatgt
tatgaaagcctgagttgcacggtattgccgcttgccgcagagggcagttaccgcttcgac
taa

DBGET integrated database retrieval system