KEGG   Cronobacter sakazakii ES15: ES15_2188
Entry
ES15_2188         CDS       T02119                                 

Gene name
vasK
Definition
(GenBank) putative type VI secretion system core protein VasK
  KO
K11891  type VI secretion system protein ImpL
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_2188 (vasK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_2188 (vasK)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_2188 (vasK)
SSDB
Motif
Pfam: IcmF-related IcmF_C IcmF-related_N DUF4233
Other DBs
NCBI-ProteinID: AFJ99761
Position
complement(2329847..2333245)
AA seq 1132 aa
MFKVKKRSLIGSTVAALLCLEAIVVFLLYACPQWVATNMGIGPFDGPRILTVCSMLAATL
LLIGWLIDKAFGYSGKSGLYFEWGKNKSLKAQHEPEILPGPDDNTQAVFSETPVTEHLRL
RYGRFWQRKVRLLLVIGEENEVEKAAPGLCRELWQEGDGNVLIYGGDGQSPQDEAFLNAL
KRLRPRCPLDGIVQVLNSQKLPTDIECDAFARCRHKAAQMLGWQVPVWLWLTDNARWLQE
TREALATGILFGPDAAPEDAMKTLNALTPRLRRAGIAQMLKNPRHDGLLYLASRLQGELK
SHIHALLQGLMNGPSAYRLRGMMFSPALAGADHALIPHTRLNTSTWQAVVDDCAEVRAKK
IGFDGVKVLQRFLLVFAVFWSTGTLLSLGVNRTDIYLAQETARQAANGKLPLADRLKNQL
ALQQTMARLQHREATGAPWYTRFGLNQDRDMLSSLWPRYAQNNTFLMRDAAAAQLHQQLD
AFIRLPPLSKARVEGTQRAYDLLKAYLMLAQPEKAEAVWLSRTLSSLWPTRQGVPDGLWQ
DLSPKLLAFYAQNLPTHPEWKVKPDAELINTVRQILLKQIGQRNAETGLYQEMLKRVASN
WPDLQLADMTGDTDASTLFTTDEVVPGMFTRQAWEEQVQGAIDEVVKSRNDAIDWVLADK
HHQPDADLSPEALKARLTARYFTDFGNAWLNMVNSIQWIEADSLSDSIAQLNLLADVRQS
PLVALMNTLNYQGKTGQQREALADSLVESAKNLIGKKKNTKAILKQAQGPEGPLDNVFGP
LTGLMEGKDGAGASGNLSFQSWLSRVTQVRLKLQQITSAPDPQAMAQMLAQTVFEGKAID
LTDTRDYGSLVAASLGQEWSGFGQALFVQPLDLAWRPVLAPAASGLNERWKTTIVEQWNT
AFAGRYPFKATGSDASMPILAQFLRADSGRIATFLKNNLGGILHQEGNRWVVDPSASQGM
TVNPAFLAAINQLATIADTVFEQGDAGVRFELMARPSRDVARMLLTLDGQKLDYFNQMES
WRSFSWPGETWYPGVDLSWRTVSSGMQLYSNNAGKWGFIRLLGKAQITPVDSSRIQLVWV
APDGSPLKFIMRTELGDGPLALLKLQGFTLPETIFSQQEIVPTDDEPEQGVE
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgtttaaggtaaaaaagagatcgctgattggctcgacggtggcagcgttgctttgtctt
gaagcgatagtcgtatttttgctgtatgcctgcccgcaatgggtggcaacgaatatggga
attggcccttttgatggaccgcggatcctcaccgtttgttcaatgctcgccgcaacgtta
cttcttatcggctggcttattgataaggcatttggttattccggcaaatcgggcctctat
ttcgagtggggcaaaaataagtcgctgaaagcacagcacgagccggaaattttacccggc
cctgatgacaacacacaggccgtattcagcgaaacgcctgttacagaacatcttcggctg
cgctatggccggttctggcagcgtaaggttcgcctcttgctcgttattggcgaggaaaat
gaagtggaaaaggcggcaccgggcctttgccgtgaactgtggcaagagggcgatggcaat
gtgcttatctatggtggcgacgggcagtcgccgcaggatgaagcatttttgaacgcactg
aaacgtctgcgcccacgttgcccgctggatggcatcgttcaggtgctgaacagccaaaaa
cttccgaccgacatcgaatgtgatgcgtttgcccgctgtcgtcacaaggcggcacagatg
ctgggctggcaggtaccagtttggttatggttaacggataacgcgcgctggttacaggag
acacgtgaggctcttgccacggggatcctgtttggcccggatgccgcgccagaagacgcg
atgaaaacactgaatgcgctgacgccccgtctgcgtcgggcaggtatcgcgcaaatgctt
aaaaacccgcgccatgatggtctcttgtatctggcgtcccggttacagggcgagctgaaa
tcgcatatccacgcgttgcttcagggcttaatgaacgggccttcggcgtaccggttacgc
ggcatgatgttcagccctgcactggcaggtgcagaccacgccctgattcctcacacacgg
ctgaatacctcaacctggcaggctgtcgttgacgactgcgctgaggtgcgcgcaaaaaaa
atcggctttgatggggtcaaggtactacaacgatttctgttagttttcgccgtgttctgg
agcaccggcacgctgctttcgctcggggtcaaccgtactgatatttatctggcgcaggag
acggctcgccaggcggctaacggcaaactgccgttggcagaccgcctgaaaaatcagctc
gctctgcagcagacaatggcgcgcctgcagcaccgcgaggctaccggtgcgccctggtat
actcgttttgggctgaatcaggaccgtgacatgttatcgtcgctgtggccccgctatgct
cagaataataccttcctgatgcgtgatgccgcggccgcgcaactccaccagcagcttgat
gcgttcattcgtctgccgccgctcagcaaggcaagggttgaaggaacgcagagggcatat
gatttgctaaaagcgtatctgatgctcgcgcaaccggagaaagcggaggcagtatggctt
tccagaacgctgtcgagcctctggccgacgcgtcagggcgtgccagatggcctttggcag
gatctctcgccgaagttactggcattctatgcacaaaaccttccgacccacccggaatgg
aaagtcaaacctgacgctgagctcatcaacaccgttcgccaaatcctgctgaaacaaatt
ggccagcgtaacgccgaaacgggtttatatcaggaaatgctgaaacgcgtggccagtaac
tggccggatctacagcttgcggatatgacgggtgacaccgatgcctccacactttttacc
acagacgaagtggtgccaggcatgtttactcgccaggcctgggaagaacaggttcagggc
gcaattgatgaagtggtgaaatcccgtaacgacgccattgactgggtattggcggataaa
catcatcagccggacgctgacctttctcctgaagccctgaaagcccggttgaccgcgcgt
tacttcactgatttcggtaatgcctggctcaatatggtcaacagcatccagtggattgaa
gctgactcactatcagattcaattgcccagctgaacctgctggccgatgtgcgccagtct
ccgctggtagcgctaatgaacaccttaaactatcagggaaaaaccggtcagcagcgtgag
gcgctggcggattctctggtggaatccgcaaaaaatctgataggtaaaaagaaaaacacc
aaagccattcttaaacaggcgcaggggccggaaggaccgctggataacgtcttcggcccg
ttaaccgggctgatggaaggtaaggacggggcgggcgcgagcggtaacctcagctttcag
tcctggctttcgcgcgtgacgcaggtgcgccttaagcttcagcagataacaagcgctccg
gacccgcaggcgatggcgcaaatgctggcgcagacggttttcgaaggtaaggccatcgat
ctgacggatacccgagattacggcagcctggtggcagcgagcctcgggcaggagtggagc
ggtttcggccaggcattgtttgttcagccactggatctggcctggcggccggttcttgcc
ccggcggccagtgggctgaacgagcgctggaagaccaccattgttgaacaatggaacacc
gcatttgcaggacgttatccctttaaagccaccggcagcgatgcctcaatgcccatactg
gcgcagtttttacgcgctgactccgggcgtatcgccacgtttctgaaaaataatctcggc
ggaattttgcatcaggaaggcaaccgctgggtagttgacccttcagccagccagggaatg
acggtgaatccggcgtttcttgcggcgattaatcaactggcgactatcgcagatacggtc
ttcgagcagggtgatgccggggtacgctttgagctgatggcccgtccgtctcgcgatgtt
gcccgaatgctgttgactctggatgggcaaaagctcgattacttcaaccaaatggaaagc
tggcgaagctttagctggcctggagagacatggtatccgggcgtcgatctcagctggcgt
accgtcagcagcggtatgcagctttacagtaataacgccggtaaatgggggttcattcgt
ctgttaggcaaagcgcaaataacgccagtcgacagcagccggatacagctcgtgtgggtc
gcgccagacggcagcccgcttaaatttattatgcgtactgaactgggcgacggcccgctt
gcgttactgaagctgcaaggatttacgctgcctgaaaccattttcagccagcaagaaata
gtgcccacggatgatgagccagaacaaggagttgaataa

DBGET integrated database retrieval system