KEGG   Cronobacter sakazakii ES15: ES15_2198Help
Entry
ES15_2198         CDS       T02119                                 

Gene name
impB1
Definition
(GenBank) putative type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
csk  Cronobacter sakazakii ES15
Brite
KEGG Orthology (KO) [BR:csk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_2198 (impB1)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_2198 (impB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AFJ99771
Position
complement(2344438..2344935)
Genome map
AA seq 165 aa AA seqDB search
MSGSFQEEIPKARINLKLNLHTGGAQKKVELPLKLLVTGDFSHGQEHRPLSERKKIDINK
NNFDSVLSEFSPALNLAVENTLAGDGREENVRLTFRQMKDFEPEQVARQIPQLKAMLAMR
NLLRDLKSNLLDNATFRRELETILKDPALSDGLRAELASLAPKHA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttcatttcaggaagaaattcctaaagcccgtattaacctgaagttaaatctg
cacaccggcggcgcgcagaaaaaagttgagctgccgctgaaattactggtcaccggcgat
ttcagtcacggccaggagcaccggccgctgtctgagcgcaaaaaaatcgacataaacaaa
aataatttcgacagcgtgctttcggaattttcaccggcgctgaatctcgccgtggaaaat
accctggccggtgacgggcgcgaagaaaatgtgcgcctgaccttccgccagatgaaagat
ttcgagccggagcaggtggcgcggcaaattccccagctgaaagccatgctcgcgatgcgc
aatttactgcgcgacctgaaatccaatctccttgataacgccaccttccgcagggagctg
gaaaccatcctgaaggatccggcgctgagcgatggcttacgcgcggaactggcgtcgctg
gccccgaaacacgcctga

DBGET integrated database retrieval system