KEGG   Cronobacter sakazakii ES15: ES15_2681Help
Entry
ES15_2681         CDS       T02119                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00010  Glycolysis / Gluconeogenesis
csk00260  Glycine, serine and threonine metabolism
csk00680  Methane metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01120  Microbial metabolism in diverse environments
csk01130  Biosynthesis of antibiotics
csk01200  Carbon metabolism
csk01230  Biosynthesis of amino acids
Module
csk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csk_M00002  Glycolysis, core module involving three-carbon compounds
csk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_2681 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ES15_2681 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ES15_2681 (gpmA)
Enzymes [BR:csk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ES15_2681 (gpmA)
Membrane trafficking [BR:csk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ES15_2681 (gpmA)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ES15_2681 (gpmA)
  Exosomal proteins of melanoma cells
   ES15_2681 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFK00255
Position
2876298..2877050
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGYSFDFAYTSVL
KRAIHTLWNILDGLDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPALTKDDERFPGHDPRYAKLSEQELPLTESLALTIDRVIPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaagctggttctggttcgtcacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgacgttgacctgtctgagaaaggcgtcagcgaagcgaaagcc
gcgggcaagctgctgaaagacgaaggctacagctttgactttgcttatacctccgtgctg
aaacgtgccatccacacgctgtggaacatcctggacgggctggatcaggcctggctgccg
gttgaaaaatcctggaaactgaacgagcgtcactacggcgccctgcagggtctgaacaaa
gctgaaaccgctgaaaaatacggtgacgagcaggtgaaacagtggcgtcgcggcttcgcg
gtgactccgccggcgctgaccaaagatgacgagcgtttcccgggtcacgatccgcgttac
gcgaaactgagcgagcaggagctgccgctgactgagagcctggcgctgaccatcgatcgc
gttatcccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtaatt
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctggataacatgagcgaa
gaagagatccttgagctgaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaaaccgattaagcactactatctgggcaacgctgacgagatcgcagcgaaagcg
gcggctgtcgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system