KEGG   Cronobacter sakazakii ES15: ES15_2817
Entry
ES15_2817         CDS       T02119                                 

Gene name
hcp2
Definition
(GenBank) type VI secretion system effector, Hcp1 family 2
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_2817 (hcp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_2817 (hcp2)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_2817 (hcp2)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFK00391
Position
complement(3033608..3034093)
AA seq 161 aa
MAQDMFIKIDGIEGESLDATHKNEIQVLAWHWSVSQHSNMHSGSGGGSGKATVADFCFEH
YVDKATPNLVSYCLTGKHIKNIQFVIRKAGGDPLEYLLIKFTDVIITGVDVMGSLEDETR
PRESVRFSFTKMTEDYVMQNAEGQKAGVISASYDVKANLHG
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcacaggatatgtttattaaaattgatggcatcgaaggggagtcattagatgccact
cataaaaacgaaattcaggttttggcatggcactggagtgtctcacagcactccaatatg
cacagcggttctggtggtggttccggtaaggcgactgtcgctgatttctgctttgaacat
tatgtcgataaggcgacaccgaatctggtgagctactgtctgaccggtaaacatattaaa
aacatccagtttgttattcgtaaagcgggcggagatccgctcgaatatctgctgattaaa
ttcacggatgtcattattaccggcgtggatgtaatgggatcgctggaagatgaaacacgt
ccgcgtgaatcagtgcgcttctcatttaccaaaatgaccgaagattatgtgatgcagaat
gcggaaggtcaaaaagcaggcgttatttctgccagctatgacgttaaagctaacctgcac
ggctaa

DBGET integrated database retrieval system