KEGG   Cronobacter sakazakii ES15: ES15_2819
Entry
ES15_2819         CDS       T02119                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
csk  Cronobacter sakazakii ES15
Brite
KEGG Orthology (KO) [BR:csk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_2819
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_2819
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFK00393
Position
complement(3035771..3036301)
AA seq 176 aa
MVNKSNSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPLEPLLAVADR
KFLDIDIDNFDERMKAMKPRVAISVPNTLSGEGQLMVDISFESMDDFSPDAIAKKAEPLA
QLLEARTQLATLQTYMDGKAGAEGLVMQLLNDKSLLKTLASSPKPQQASAEVEREE
NT seq 531 nt   +upstreamnt  +downstreamnt
atggtaaataaaagtaattcacagaaatttatagccaggaaccgggcgccgcgcgtacaa
attgagtacgatgtggaaatttatggcagtgaaaaaaagattgagctccctttcgtcatg
ggcgtactggcggatttatccggtaagccactggagccattgctggctgtcgcggacaga
aagtttctggacatcgacatcgataatttcgatgaacgcatgaaagcgatgaaaccgcgc
gtagctattagcgtcccgaatacgctttccggcgaaggacagctgatggtggatatttcc
tttgaaagtatggatgacttttcgccagacgctattgcgaagaaagcggagccgttagcg
caattgctggaggcccgcacgcaattggcgacgctgcaaacttatatggatggtaaagct
ggcgcagaaggactggtcatgcagttacttaacgataaatccttattaaaaacattagct
tcctcgccgaaaccgcagcaggcttcagcggaagtcgagcgggaagagtaa

DBGET integrated database retrieval system