KEGG   Cronobacter sakazakii ES15: ES15_3293Help
Entry
ES15_3293         CDS       T02119                                 

Definition
(GenBank) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00740  Riboflavin metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
Module
csk_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ES15_3293
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     ES15_3293
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     ES15_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFK00867
Position
complement(3568896..3569834)
Genome map
AA seq 312 aa AA seqDB search
MKLIRGIHNLTSEHHGCVLTIGNFDGVHRGHQALLAGLCAQGRERGLPVMVMIFEPQPLE
LFAADKAPARLTRLREKLRYLARCGVDYVLCIRFDRRFAALTAQNFVSDLLVERLGVKFL
ATGDDFRFGAGREGDFLLLQKAGREYGFEVTSTQTFCEEGVRISSTAVRQALAQDDLSLA
ENLLGRPFAICGRVVHGDALGRTIGFPTANLPLRRQVSPVKGVYAVEVLGISDKPLPGVA
NIGTRPTVAGLRQQLEVHLLDVAIDLYGRHIDVVLRKKIRNEQRFASLDELKAQIARDVI
TARDFFGLPTPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatacgcggcatacataatctcacctctgagcatcacggttgcgtgctgacc
atcggcaatttcgatggcgtgcatcgtgggcaccaggctttgcttgccgggctatgcgcg
caagggcgcgaacgcggcctgcccgttatggtcatgattttcgagccgcagccgcttgaa
cttttcgcggccgataaagcgcctgcacggcttacccggctgcgcgaaaagctgcgctac
ctcgcccgttgcggcgtggattacgtgctgtgcattcgttttgaccgccgctttgccgcg
ctgacggctcagaatttcgtcagcgatctgctggtcgagcgcctcggcgtgaaattcctg
gcgaccggtgacgatttccgctttggcgctggtcgcgaaggggatttcttgttattacag
aaagccgggcgcgaatatggttttgaagtcaccagtacacaaacgttttgcgaagagggc
gtgcgcatcagcagcaccgccgtacgccaggcgctcgcgcaggatgacttaagcctcgca
gaaaacctgctcggacggccattcgccatctgcgggcgcgtggtccacggcgacgcgctc
ggacgcaccataggtttcccgacggcgaatttaccgctgcgccgtcaggtttcgcccgtt
aagggcgtttatgcggtggaggtgctgggcatcagcgacaaaccgctgcccggcgtcgcc
aatatcggcacccgcccgacggtggccggcctgcgccagcaactggaagttcacttgctg
gacgttgcaatcgacctctacggccgccatatagatgtagtgctgcgtaaaaaaatacgc
aatgaacagcggtttgcctcgcttgatgaactcaaggcgcaaatcgccagagacgtgatc
accgcccgcgacttttttgggctaccgacaccggcgtaa

DBGET integrated database retrieval system