KEGG   Cronobacter sakazakii ES15: ES15_3808
Entry
ES15_3808         CDS       T02119                                 

Definition
(GenBank) putative type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_3808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_3808
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_3808
SSDB
Motif
Pfam: Phage_GPD Phage_base_V bCoV_SUD_C
Other DBs
NCBI-ProteinID: AFK01382
Position
complement(4157649..4159580)
AA seq 643 aa
MLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQA
LMTPRYLNGKVTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKT
LLGESRVNMEERLSGSYRVWEYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLVLTD
APGQYEPFPGYETIPYHVTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQ
ARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQVEHRQTQGTATALGIAPGHT
FVLRNAPFFGDNGEYLTTIAHYRFEENRYASGPDSNTLHEIRFEVIPADVPYRPAQKTPW
PRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNA
NALRFEDKAGEEQVWLQAERNLDTKVKKDETHSVGGSRILSVKQDYTGKVEGKQEHAIQM
SRNELVGGQYDIKGQGTVTVSSATGIRLVTGDSVLEMSANGEVNLYCTKFAINASGTGQI
NTGGTLDLNLKNEPDKASNVAPTPGDIQNEVAKTFNSDGEGQA
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgctcaaccgaatcaccgttcagctcccggtcgaggggctgcttttctggaaactctcc
gggcgcgaggcgctgtcggagccgtttatgttcaccctgacgctgctcggcaccgacgcg
cgggccgaccgcagcgcgctgctgggccagccggtgacggtgaccatcccgacccaggcg
ctgatgacgccgcgctacctcaacggcaaggtgacccgtgtggcagtgagcgcggtggag
ctctccggcacccggtacgcggcctatgagctgacggtggagccggacctgtggccgatg
cagcgcgaccgcaacctgcgtatcttccaggggcagacggtgccgcagatagtgaaaacc
ctgctcggcgagagccgggtgaatatggaagagcgtctttccggcagctaccgcgtctgg
gaatactgcgtgcagtaccaggagagcagcctcgatttcatcagccgcctgctggagctg
gagggtattgcctaccacttccgccacgagcaggaccgccacacgctggtgctgacggac
gcgccgggccagtacgagccgttccccggctacgaaaccattccgtaccacgtcacgccg
tccggtggcagcacagacgaagagggcatcagccagtgggcgctggaagacagcgtgacg
ccgggcatctacagcctcgacgactacgacttccgcaagcccaacgcgtggctgttccag
gcgcggcagaacccgctgtcgccgcagccggggagcattgacgtttacgactggccgggc
cgttttgtggagcacggtcacggcgagttctacgcccgcatccgccaggagcgctggcag
gttgagcaccgccagacccagggcaccgcgacggcgctcggcatcgcgcccggccacacc
tttgtgctgcgcaacgccccgttcttcggcgataacggcgagtacctcaccaccatcgcc
cactaccgctttgaggagaaccgctacgccagcggcccggacagcaacaccctgcatgaa
atccgctttgaggtgataccggcggacgtgccgtaccgcccggcgcagaagacgccgtgg
ccgcgcacctacggcccgcagacggcgaaggtggtcggcccgcagggcgagagcatctgg
accgataaatatggccgggtgaaggtgaagttccactgggaccgcctcggcaagggcgac
gacaccagctccagctgggtgcgtgtctccagcgcctgggcgggccagggcttcggcggg
gtgcagataccgcgcgtgggcgacgaagtggtggtggacttcatcaacggcgacccggac
cgcccgctgataacgggtcgcgtgtataacgaagccagcatgccgccgtgggcgctgcct
gccgcggccacacagatgggctttttaagccgctcgaaggacggctcgccggacaacgcc
aacgccctgcgctttgaggacaaggccggtgaggagcaggtatggctccaggccgagcgc
aaccttgataccaaagtgaaaaaagatgaaacccacagcgtcggcggctcgcggatactt
tctgtaaagcaggactacaccggcaaggttgaaggcaagcaggaacacgccattcagatg
agccgcaatgagctggtcggggggcagtacgacatcaagggccagggcacggtgaccgtt
tcttccgcgactggcattcgcctggtcacgggcgattcggtgctggaaatgagcgcgaac
ggcgaggtcaatctctactgtacaaaattcgcgatcaacgccagcggcacagggcaaatc
aataccggcggcacgctcgatctgaaccttaagaatgaaccggacaaagcgtcaaacgtc
gcgccgacacccggggatatccagaacgaagtggcaaaaacatttaattccgacggagag
ggacaggcatga

DBGET integrated database retrieval system