KEGG   Cronobacter sakazakii ES15: ES15_3833
Entry
ES15_3833         CDS       T02119                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
csk  Cronobacter sakazakii ES15
Brite
KEGG Orthology (KO) [BR:csk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_3833
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_3833
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFK01407
Position
complement(4184958..4186829)
AA seq 623 aa
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRV
QLKMDAEFPRFSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQL
LKKNGVTCSYATAHDVRLLPLHISQVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGP
VLLNHLDFDRLDFFLSGPDIQALQLLELLMEHRVGIFCQTVGPKPSRVVLADDALRQEGF
EADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGIGKLLAQSGQANAFDIIILLDKT
DTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPLDYEIFSVSKI
YASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSLRREQRALSEHALRYGTRTGYVGSEAFV
SLVDASHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPR
PALAEGFSTWRLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHC
VLEPVHRRVPEPGPIVFARGVGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEF
TLKSQQRGEVGYWGPRMGKRALI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggacagtaaactgctcgaatattacaaccgagagctggcgtatctgcgcgaaatgggc
gcggagttcgccgaacgctacccgaaagtggcgggcaggctcggtatgcgcgggattgaa
gtcgctgacccgtacatcgagcgcctgatggaaggcttcgcctttctcacctcccgcgta
cagctcaaaatggacgccgagtttccgcgcttctcccagcgcctgctggagatgctcgcg
ccgaattatctggcccccacgccgtcaatggcgatagccgaactgcacccggacagcgcc
aaaggggatctgagcaacgggtttgtggtgccgcgcggcacgatgatggacagccagctt
ctgaaaaagaacggcgtcacctgtagctacgccaccgcccatgacgtgcgcctgctgccg
ctgcatatcagccaggtggagttaggcggcgtgccggccgatgcgccgttaagccagctc
ggtttaagccagcgcggcgcggtcagcgccctgcgcgtgcggatcgcgtgcgacggcccg
gtgctgctcaaccatctcgatttcgaccgcctcgatttcttcctgagcgggccggatatc
caggcgctgcaactgctggaattgctgatggagcaccgcgtcggcatcttctgccagact
gtcggcccgaaaccctctcgcgtggtgctcgccgacgacgcgctgcgtcaggaaggcttt
gaggccgaccaggcgctgctgccggacgatctgcgcaatttcgacggctaccgcctgttg
caggaatatttcgcgttcccggcgcgcttccagtttttaagcctgcgcggcatcggtaag
ctgctggcgcagagcgggcaggcgaacgcgttcgatatcatcattctgctggataaaacc
gacacgccgctggagcgcgtggtggataagagccacctcgcgatgcactgcacgccggtc
atcaatttgttcccgaaaatcgccgagcgccagaagctcaccgagggcttaagtgaatat
cacctggtggtggataacattcgcccgctcgattacgagattttctcggtcagtaaaatt
tatgccagcgaagacggccagcgcgacgaccagatttttcgcccgttctggagcacctgg
agccgcgacggcggcaactacggcgcgtatttctcgctgcgccgcgaacagcgcgcgctc
tcggaacacgccctgcgctacggcacgcgtaccggctatgtcggctccgaggcgttcgtg
tcgctggtggacgcaagccacgcgccgtggcgcgacgaactgcgctatatcaccgccgaa
gtgatgtgcaccagccgcgatctgccgctgatgctggcgcaggatatgggccagtttgtg
ctgccggattccatgccggtgcgcgcgctcaccatgcgtaaagggccgacgccgccgcgc
ccggcgctggccgaaggcttcagcacctggcggcttatcagccagctgcaaatgaactac
ttaagcctgatggacgccgaagatggcgagggcgcggcggcgctgcgccagctgctcggc
ctctatgcgcgcctggcggaagcgccggtggcgcgccagattgacggcattcgccactgc
gtgctggagccggtgcaccgccgcgtgccggagccgggcccgattgtgttcgcccgcggc
gtcgggatttcgatgaccgtcgatgagcaggcgttttccggctccagcccgtggctgctt
ggcagcgtgctggagcgcgtcttcgcacgcctggtctccatgaacagcttcaccgagttc
acgctcaagagccagcaacgcggcgaagtgggctactgggggccgcgaatgggtaaaagg
gcgctgatatga

DBGET integrated database retrieval system