KEGG   Cronobacter sakazakii ES15: ES15_3838
Entry
ES15_3838         CDS       T02119                                 

Definition
(GenBank) type VI secretion system FHA domain protein
  KO
K07169  FHA domain-containing protein
Organism
csk  Cronobacter sakazakii ES15
Brite
KEGG Orthology (KO) [BR:csk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    ES15_3838
SSDB
Motif
Pfam: FHA UreE_N Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AFK01412
Position
complement(4190070..4191986)
AA seq 638 aa
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGEC
RITNRGNVTRVVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPN
VAPQQPQAPQPAKPQQPPKADAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKT
PEAQPFNPFNAPKEADRNPEDPLAHFQSGGNEPLFGNERVNPDSLFKDDTPFDKDSIFND
VTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGSTPVQSRSDDPLGLMMGGAVP
LTPPDELNAGAAPLTPPPAAKQDAEPVKPPVSPEKPQPEMTTSPLAPNADDSIDLASLAG
SPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDPVQSPT
SQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALL
SSRSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDL
QAHQLGMIAGIRAIIAAMLQSFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSD
TAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEEE
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgcgattcacgattactaccaacaagcccggccaccagcctcctcagagcagctgtgac
ttctacccgccgggcggcacgattggccgtggtacggataacaatctggtactgccggat
aacgaaagaacgatttcccgcctgcaggcgattgtccatatctccgcggacggcgagtgc
cgcatcactaaccgcggcaacgtcacccgcgtggtgctgaacgatattccgctggagcgc
ggccgccaggtggagttacaggatggcgacgtactcggcattgacgattaccgcatccag
gtgagcgatctggcgctgaacgcgcagccggttatcgcgatggccgcgccgaaaccgaac
gtcgcgccgcagcagcctcaggcgccgcagcctgcgaaaccgcagcagccgccgaaagcc
gacgcgcaggacaacgcgccgacggcggtgccgaccgaaatctgggacagcctgatgcag
gagttctctatctccgacagcatcagtcaggggcagagccagagcgcgcgcccgaaaacg
ccggaagcgcagccgtttaacccgttcaacgccccgaaagaggcggatcgcaacccggaa
gatccgctggcgcacttccagagcggcggcaacgagccgctgttcggcaatgaaagggtc
aacccggacagcctgttcaaagatgacacgccgttcgataaagacagcattttcaacgat
gtgaccccgaccacgctggtgccgccgtctgataaccgtcaggccgcaaaaccgcaggca
ccgcataaagagaatgaagaagagctcgatccgctggcgctgtttggcggcgtgggctcc
acgccggtacagagccgcagcgacgatccgcttggcctgatgatgggtggcgctgtgccg
ctgacgccgccggatgagcttaacgcaggcgctgcgccattaacgccgccgcccgccgcg
aagcaggacgctgagccggttaagccaccggtttcacccgaaaaaccgcagccggagatg
acgacctcgccgctcgcgccaaacgcggacgactcaatcgatctggcgtcgctcgccggt
tcgccgctgttcccggaagaagtgccggaagagccggtgacgcgcgtggaagtccagccg
acgccgccggaagtgcaggattacgcgggtatcacgctgccgacgccgcaggcggtggcg
cgcagcaccgcgcagacgccaaaaggccgcctgcgcatcgacccggtgcagtcgccgacc
agccagggcggcacgccaacggcgtctaacggcgacgtgctgaacggcgagctgctggaa
gcattgctggaaggtatggggcttggcgagctgcaaccaacgccgcagtttgaccgcgac
aatatgcgccagctcggccagatgctcagcatgttctcgcagggcaccgtggcgctgctc
tcctcgcgctcgattctcaagcgcggcgtgaaagccgacatgacgatggtgctggacgac
gccaacaacccgttcaagctgctgccgtcgggcaaaacggtactgatgcaaatgttcggc
acccgtatgccgggctttatgccgccgaaaaaatcggtccgcgatgcgcttatcgatctc
caggcgcaccagcttgggatgatcgccggtatccgcgccatcattgccgccatgctgcaa
tcctttaacccggagcagcttgaagaagaggcgaagcgcgacggcgctatctcgcgtctg
gcgctgccggcgagccgcaaagccgcgctgtgggattactttgtgcgtcattacagcgat
accgcgggcgagatcgaggacgatttccatactctgttcggcgaagccttcctgcacgct
tatgacatggaagtgaatcagtacaaagactcacaaagcggatcggaagaagaatga

DBGET integrated database retrieval system