KEGG   Cronobacter sakazakii ES15: ES15_3841Help
Entry
ES15_3841         CDS       T02119                                 

Gene name
hcp3
Definition
(GenBank) Hcp1 family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_3841 (hcp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_3841 (hcp3)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_3841 (hcp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFK01415
Position
complement(4193062..4193544)
Genome map
AA seq 160 aa AA seqDB search
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNA
LIDKSTTAILKHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTV
GVTYAFQAAKVKQQYWEQTATGGKGAETSAGWNIKENKEA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctattgatatgttcctgaaagtagacggtgtaaccggcgaatctaaagattccaac
cacaccggctggaccgacatcacctctttttcctggggcgcatcccagccgggtaatatg
agcgtgggcggcggcggcggtgccggtaaagtgaatttcaacgatctgcacgttaacgcg
ctgatcgacaaatccaccaccgctatcctgaagcactgctccagcggtaagcacctgacc
aaagttgagctgtctgtctgcaaagcgggcggccagcaggtggaatacacccgtatcacg
ctggaagacgtgctggtgacttccgttcagtacaccggtgctgacaacggcgacaccgtt
ggcgttacttatgcattccaggctgcgaaagtgaaacagcagtactgggagcagactgcg
accggcggtaaaggcgcagaaaccagcgctggctggaacatcaaagaaaacaaagaagcg
taa

DBGET integrated database retrieval system