KEGG   Cronobacter sakazakii ES15: ES15_3849Help
Entry
ES15_3849         CDS       T02119                                 

Gene name
impL
Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_3849 (impL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_3849 (impL)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_3849 (impL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AFK01423
Position
complement(4198986..4202606)
Genome map
AA seq 1206 aa AA seqDB search
MLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWV
HSHIVPRLYNAWLNRKLMDKLNEGKPAEEGGSDVKRLGNDDKVLADRFDEAAQILKKAHF
NAPGQRGQWTQRFSTQYLYQLPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIG
GTRNCDWWFTNEAVLLDTAGRYTTQESEQAQDAGEWLSFVDLLRKYRRRQPINGVIITIS
VSDLLTQSPEATQQQAVNLRQRLAELHEQLGIRFPVYVLVTKADLLKGFRSYFGRFDKAQ
RDQIWGFTFPWDRSKQADFDLLGAFTQEFALLQQRLDAGLPDTLLAESDPKARAECYLFP
QEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRALSLPSG
GKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYA
ALIALLVVLGGLWLTSYGNNKDYLAEVNDKVPGVERQSKALQTTAGRDLFSMLPFFNSLV
DLPKSKEFDLNSPPVTYRMGLYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRNDNG
SDVEYSYEALKAYQMLYQPKHYDGKFLHSWVMLNLERNLPQNVTQAQLNQLEWHLTQLLE
PQIQTSPYAKDESLISRQQAMINQKPLSLRVYGRLKRLLERDENLKLVSLATLGGPQSEL
VFSRKSGKPVSDGVPGLYTPKGYWESFNGQIDNVTASLHDDDTWVLGLTTAQEDKTQTDN
AVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLSQVLTLS
RAEPQAGEGEAKEQGNRATRTLEALFSDRESGATTAAAAPQTPEQVVTDHYAPIIELAQP
LEKGGKTIVFDDFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNM
FSRMAVGASSDTQQRELENVRKRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFA
PGTGLMDSFFRDNLTNKVDTTQQRWRFTPGIDGKTLPGSEGVLRPFQQAQYIRDAFFANG
ATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYSHGPQAVQLMSWPGSGGTNQVRMQLGL
ANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHSVTLEFTPNSIRNPFQL
PGFACP
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatattctcctttcaatagtgaccaaccgcatcttgtgggggttcatgggcgtt
accgcgctgtcggcggtcgtctggatgatcgggccattgctgtccatcgtcgacagccgc
ccgctggagtcggaaaccaaccgtatcatcagcattgcgcttatctacctgatttgggtg
catagccacatcgtgccgcggctctacaacgcctggctgaaccgcaagctgatggacaaa
ctcaacgaaggcaagcctgcggaagagggcgggagcgacgttaagcgcctcggcaatgac
gataaagtgctggcggaccgctttgacgaagccgcgcagatccttaaaaaagcgcacttc
aacgcgccgggccagcgcggccagtggacgcagcgttttagtacgcagtatctctatcag
cttccgtggtatgtgattatcggcgcgccgggttccggtaaaacgacggcgctggtcaac
tccggcctgcaattcccgctcgccgatcgctttggcaaaacggcgctgcgcggcattggc
ggcacccgcaactgcgactggtggttcaccaacgaagcggtgctgctcgataccgcaggc
cgttacaccacgcaggagagcgaacaggcgcaggacgccggtgaatggctaagctttgtc
gatctgctgcgtaaataccgccgccgccagccgattaacggcgtcattatcaccatcagc
gtttctgatctgctgacccagtcgccggaagcgacgcaacagcaggccgtcaacctgcgc
cagcgtctggcggagctgcatgagcaactcggtatccgcttcccggtctatgtgctggtg
accaaagcggacctgctgaaaggctttcgttcttactttggtcgctttgataaagcgcag
cgcgaccagatctggggcttcaccttcccgtgggatcgctcaaaacaggccgattttgac
ctcctgggcgcgttcacccaggagttcgcgctgctccagcagcgtctcgacgcgggcctg
ccggatacgctgcttgccgaaagcgacccgaaagcgcgcgccgagtgttatctgttcccg
caggagttcgcggcgctgcgtccgctgctcgcggattacctcagcaccgtttttgcccgt
tctaactttgaaaccgaattctcgccgcgcgggatttatcttgcgagcgggacgcaggaa
gggctgccgtttgaccgcgtgatgggcgaactcaaccgcgcgctgtcgctgccgtccggc
ggcaaagagggcgacaactgggattcggtgagcaaagaagcgccgatccccggcggtaaa
gggcaaagcttctttattaaaaacctgctgcaaaacgtgattttccaggaagcgggcatc
gccgggcagaaccgctggtgggagctgcgcaaccgcgcggtgctgtggtctggctatgcg
gcgctgatagcgctcttagtggtgctgggcggtctgtggctcaccagctatggcaacaac
aaagactatctggcggaagtgaacgataaagtgccgggcgtcgagcgccagagtaaagcg
ctgcaaaccaccgccgggcgcgatctcttcagcatgctgccgttctttaacagcctggtg
gatctgccaaagagtaaagaatttgacctgaactcgccgccggtgacgtaccgcatgggg
ctttatcgcggcgatgacgtcaacgacgcttcgcaggcgctctaccagaaagcgctgcag
gaaatgctgatgcctgccgtggcgcagctcatcaccggctgggtgcgtaacgacaacggc
agcgacgtggaatacagctacgaagcgctgaaggcgtaccagatgctctaccagccgaag
cactacgacggcaaattcctgcactcttgggtgatgctcaaccttgagcgcaacctgccg
cagaacgtcacccaggcacagcttaaccagctcgaatggcatctgacgcaactgctggag
ccgcagatccagacctcgccgtacgccaaagatgagtcgctgatcagccgccagcaggcg
atgatcaaccagaaaccgctgtcgctgcgcgtctatggccgcctcaagcggttgctggag
cgcgatgaaaacttaaagctggtgtcgctcgccaccctcggcgggccgcagagcgaactg
gtgttttcgcgtaaaagcggcaaaccggtgagcgacggcgtgccggggctctacaccccg
aaaggctactgggaaagtttcaacggccagattgataacgtcaccgcctcgctgcatgac
gacgacacctgggtgctgggcctgaccaccgcgcaggaagataaaacgcagacggacaac
gcggtgcgtcagctctatatgcgcgactttatcagccagtgggacagctacctggcggat
attcagcttaacaacagcgccgatctgaaccagcgcattaacacggcccgcgtgctttcc
agcagcaactcgccgctgcgccgcctggtgatgaacttaagccaggtgctgacgctctcc
cgcgccgagccgcaggcgggcgaaggggaagcgaaagagcagggcaaccgcgcgacccgc
acgctggaggcactcttcagcgaccgcgaaagtggggcgactaccgccgccgccgcgccg
caaacgccggaacaagtggtgaccgatcactacgcgcccatcatcgaactggcgcagccg
ctggagaaaggcggcaaaaccatcgtgtttgatgactttatcaagcagatcgatgagctc
taccgctacctgaccgccgtacaggacgccgccaacagcggtatgccaccgccgggcggc
gaagcgatcagccgtttacaggcgagcgccgggcgtctgccgggcgggctgcaaaatatg
ttcagccgcatggcggtaggggcgagcagcgacacccagcagcgcgaactggaaaacgtc
cgcaagcgtatcagcgtggaagtcggcagcttctgccgccaggcgattgccggccggtac
ccgctggtgcgctccgccagcagcgaagtgacgccggacgatttggcgcgtatgttcgcg
ccgggcaccggcctgatggacagcttctttcgcgataacctgacgaataaagtcgatacc
acccagcagcgctggcgctttacgccaggcatcgacggcaaaacgctgccgggcagcgaa
ggggtgctgcgtccgttccagcaggcgcaatacattcgcgacgcgttcttcgccaacggc
gcgaccacgccgtcttatcgcgtgacggtgcgcaccgtgcggatggataacgacattctg
acgctgtcgctcgacgttgacggccagcttctgcgttacagccacggcccgcaggcggtg
cagctgatgagctggccgggcagcggcggcacgaatcaggtgcgtatgcagctcgggctt
gccaacggcaccacctcgacgctcgtgaccaacggcgcgtgggcgctgaaccgctttttc
gatcgcgcccgcattgcgccgggtgcaggaagcctgagccgccaggcgacgttttcggtt
gacggacacagcgtgacgctggaattcacgccgaacagtatccgcaacccattccagctc
cctggcttcgcatgcccttaa

DBGET integrated database retrieval system