KEGG   Cronobacter sakazakii ES15: ES15_3852Help
Entry
ES15_3852         CDS       T02119                                 

Gene name
vasD3
Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family 2
  KO
K11906  type VI secretion system protein VasD
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ES15_3852 (vasD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:csk02044]
    ES15_3852 (vasD3)
Secretion system [BR:csk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ES15_3852 (vasD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN DUF5345
Motif
Other DBs
NCBI-ProteinID: AFK01426
Position
complement(4205229..4205735)
Genome map
AA seq 168 aa AA seqDB search
MKNRTVLRQGFLAFLIAALTLLSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLK
SDADFMSADFFSLQNNAQTVLGANLLNSDEFFLMPGQLNKTLSGQSSLDARYIGVMAEYQ
ALDGKKWRISLPLPAPSDSSIYKFWKWSSDELEAKVFLDVNGIRVINE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccgtaccgttttacgccagggcttcctggcgtttttgattgccgctctcacc
ttactgagcggctgcttatcgtcttcacgcagcgttccttcccagtacagcctgcatttt
caggctcacccgcaaattaataattccgccccgctaaaagtccgggtgctgcttttgaaa
tcagacgccgactttatgtctgcggatttcttttcgctgcaaaacaatgctcagaccgtg
ctgggagccaacctgctcaacagcgacgagttcttcctgatgccgggccagctgaacaaa
accctcagcggccagagctcgcttgacgcgcgctacatcggcgtgatggcggaatatcag
gcgctcgacggcaaaaaatggcgaatctcgctcccgctgcccgcccccagtgactccagc
atttataaattttggaaatggtcatccgacgaacttgaggcaaaagtgtttcttgacgtc
aatgggatccgcgtcatcaacgaataa

DBGET integrated database retrieval system