KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_12173Help
Entry
COCSUDRAFT_12173  CDS       T02914                                 

Definition
(RefSeq) heat shock protein 70
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl03040  Spliceosome
csl04141  Protein processing in endoplasmic reticulum
csl04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    COCSUDRAFT_12173
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    COCSUDRAFT_12173
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    COCSUDRAFT_12173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA
Motif
Other DBs
NCBI-GeneID: 17044587
NCBI-ProteinID: XP_005651121
JGI: 12173
UniProt: I0Z7F8
AA seq 235 aa AA seqDB search
MEGTSPVVIPVTPQGNVLPSVVSFAEEDEVVVGWTAKRRATSCPKDTFASVKRLIGRRLD
EAKDQAKMVPYRVGRDEEGNVQLLCDFVEGGVLYPEEVSAYVLAELLSAAEAITETSIKK
AVISVPAYFGEEQREATIQAGRLAGLDTVKLIREPVAAALAYGIKAVEDEVILVLDLGGG
TFDVSILEVGGGTIEVLSTGGDALLGMPPSLWWAVATQPTKTDVKMPGVTAGSTK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagggcacttcgcctgttgtcataccggtgactcctcaggggaatgttctgccatca
gtcgtgtcattcgcggaagaggacgaggtggtagttgggtggaccgccaaaaggcgggca
acttcatgtcccaaggacacatttgcgtcggtcaagcgcttgattgggaggaggcttgac
gaggcaaaggaccaggctaaaatggtgccttacagagtgggcagggatgaagagggcaac
gtgcagctcttatgtgattttgtggaaggcggtgtcctctaccctgaagaggtgtcagcc
tacgttctggccgagcttctgtcagctgcagaagctatcacagagacctcgatcaagaag
gctgtgatatcggtccccgcttattttggggaggagcagcgagaggcgaccatccaggca
ggtcgccttgccggactcgacacagtcaaacttatcagggagcctgtcgctgcagcgctg
gcatatggaatcaaggccgtggaggatgaagtgatacttgtgcttgatcttggcggtggc
acctttgatgtgtccattctggaggttgggggcggcaccatcgaagtcctgtccactggc
ggcgatgctcttctgggtatgcccccttccttatggtgggcagtcgccactcaacctacc
aagactgatgtcaaaatgccgggggtcacagcagggtctacgaagtag

DBGET integrated database retrieval system