KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_13342Help
Entry
COCSUDRAFT_13342  CDS       T02914                                 

Definition
(RefSeq) MT-A70-domain-containing protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
csl  Coccomyxa subellipsoidea
Brite
KEGG Orthology (KO) [BR:csl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csl03019]
    COCSUDRAFT_13342
Enzymes [BR:csl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     COCSUDRAFT_13342
Messenger RNA biogenesis [BR:csl03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     COCSUDRAFT_13342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 17043153
NCBI-ProteinID: XP_005649694
JGI: 13342
UniProt: I0Z3D1
AA seq 378 aa AA seqDB search
MPGGPFGPGQSPQRPAQKRGAPANELDSLLNKPTLQDRLKTEKGEELLELIAKPTAKENA
VVKRFKTEGGSQIREYCPHLTKDDCRRAHASMFPCHRVHFRRLVFPWTDVSMGNCSYLDT
CRHMKTCRYVHYELDDEPDLAGPVATDAAKSRPPVPAYLAVCKQFSRGSLDARWIKCDIR
TFDMTVLGKFGVIMADPPWEIHQDLPYGTMADDEMRKLNIGTLQDEGVIFLWVTGRAMEL
GRECLEIWGYKRVDELIWVKTNQLQRLIRTGRTGHWLNHSKEHCLVGVKGSPNINRSLDC
DVLVGEVRETSRKPDEMYSLLERLSPGTRKVEIFARQHNVQPGWVCLGNQLNGVVIREPE
MLERYEAKYGPVPAPSKA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcggcccgttcgggcccggacagtcgccgcagcggccagcccagaagcgcggc
gcgcccgccaacgagcttgactcgctcctgaacaagcccacccttcaggatcgcctcaaa
acagagaagggtgaggagctgcttgagctgatagcaaagccgacggcaaaggagaatgcg
gtggtgaagcgcttcaagacggagggcggctcgcagatccgggaatactgcccgcacctc
accaaggacgactgccgcagggcgcacgcgagcatgtttccgtgccaccgggtgcacttc
cggcggctggtgttcccgtggacggacgtgtccatgggcaactgctcctacctggacacc
tgccgccacatgaagacctgccgctacgtgcactacgagctcgacgacgagcctgatctg
gcgggacctgtcgccacggacgccgccaaaagccggccacctgtgcctgcttacctggcg
gtttgtaagcagttctctcgagggtctttagatgcaaggtggataaagtgtgacatccgc
acatttgacatgacggtgctgggcaagtttggggtgatcatggcggaccccccctgggag
atccaccaggacctgccctatggcaccatggccgacgacgagatgcgcaaactcaacatc
ggcaccctccaggatgagggcgtcatcttcctctgggtcaccgggcgtgcgatggaactg
gggcgggagtgtttggagatctggggctacaagcgagtggacgagctgatctgggtgaag
acgaaccagctgcagcgcctaatcaggacggggcgcacggggcattggctcaaccactcc
aaggagcactgcctggtgggcgtcaagggcagccccaacatcaaccgcagccttgactgc
gacgtcctcgtcggagaggtacgggagacgtcgcgcaagccggacgagatgtactcgctg
ctagagcggctgagcccgggcacgcgcaaggtggagatctttgcgcgccagcacaacgtg
cagcccggctgggtctgcctcggcaaccagctcaatggcgttgtcatccgcgagcccgag
atgctcgagcgctatgaggccaaatacggccccgtgccagcccccagcaaggcctga

DBGET integrated database retrieval system