KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_23319Help
Entry
COCSUDRAFT_23319  CDS       T02914                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00220  Arginine biosynthesis
csl00250  Alanine, aspartate and glutamate metabolism
csl00710  Carbon fixation in photosynthetic organisms
csl01100  Metabolic pathways
csl01200  Carbon metabolism
csl01210  2-Oxocarboxylic acid metabolism
csl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_23319
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_23319
   00220 Arginine biosynthesis
    COCSUDRAFT_23319
Enzymes [BR:csl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     COCSUDRAFT_23319
Amino acid related enzymes [BR:csl01007]
 Aminotransferase (transaminase)
  Class I
   COCSUDRAFT_23319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 17042180
NCBI-ProteinID: XP_005648726
JGI: 23319
UniProt: I0Z0L3
AA seq 505 aa AA seqDB search
MVANGAVDSVKGPQPSCSPLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFD
KILYCNIGNPQQLGQHPVTFYRQVLAICDYPELLESAEAKSIFPPDVLARAKKYLAAIPG
GTGAYSDSRGAMVLRQDIAKGIEERDGYPCDPDNLFLTDGASQGVHAMMRLLLRDEKDAV
LTPIPQYPLYSATLTMYGGVLLPYYLHEETGWSLDINELREQTYKARSEGQNVRALVVIN
PGNPTGQILSYENQVDVVKFCKEEGIVLLADEVYQANIYRPDKTFTSFKKARPFLSSQPR
CLHACEEEVTLASMMSISKGFYGECGRRGGYTELVNVDPSVLSEVYKLASINLCSNLNGQ
ICMALVMNPPKEGEPSYDLYAKERTELLASLKRRALKLHKTLSALQGVTCTEPEGALYAM
PQIRLPQGAIEAAKKTGKAADFFYCMQLLEETGIVTVPGSGFKQEEGTFHFRTTFLVPEP
ETDEVAERLVKFHNSFLAKYGEPEQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgaacggtgctgtggactctgtgaaggggcctcagccttcttgttcacccttg
gccttggaaaacataaaccccaaagtggtcaaggcacagtatgctgtaaggggcgaaatc
gtgattcgtgccaaggagctggaagacaagcttcatgctggggaaaagctcccatttgac
aagattctgtactgcaacattggcaatccccagcagctagggcagcaccctgtaaccttc
tacagacaagtgctggccatttgtgactacccagagctactggagagtgcagaggcgaag
agcattttcccgccagatgtgcttgcgcgtgccaagaagtacctggccgccattccagga
ggcactggggcatacagcgacagtagaggtgccatggtgctccggcaggatattgccaag
ggcatcgaggagcgagatgggtacccctgcgatcctgacaatctgttcctaacagatggt
gccagccagggcgtgcatgcgatgatgcgcctgcttctgcgcgatgagaaggacgctgtc
ctcacacccattccccagtaccccctctactcggcgacattgacgatgtacggaggcgtg
ctgttgccctactacctccatgaagagaccggctggagcctggacatcaatgagctgcgc
gagcaaacctacaaggcgcggtcggaggggcagaatgtgagggcgctggtggtgatcaac
cctggcaatcccaccggccagatcctgtcgtatgagaaccaggtggacgtggtcaagttc
tgcaaggaggagggcatcgtgctgctggcagacgaggtgtaccaggccaacatctaccgc
cccgacaagaccttcacctccttcaagaaggcacgccccttcctctcctctcagccacgc
tgtttgcatgcatgtgaggaggaagtgacgctggcctcgatgatgtccatctccaagggc
ttctatggcgagtgcggccggcgcggcggctacacggagctggtcaacgtggaccccagc
gtgctctccgaggtctacaagctggcctccatcaacctctgctccaacctcaatggccag
atctgcatggccctcgtcatgaacccccccaaggagggggagccgtcgtatgatttgtat
gcgaaggagcgcacggagctgctggcgtcgctgaagcggcgggcgctgaagctgcacaag
acgctgagcgcgctgcagggcgtcacctgcacagagcccgagggcgccctctacgccatg
ccccaaatccgtctgccccagggcgccattgaggctgccaagaagacgggcaaggctgcg
gacttcttctactgcatgcagctgctggaggagactggcatcgtgactgttccaggttca
ggcttcaagcaggaggagggtacgttccacttcaggaccacattcttggtgccagagcca
gagactgatgaggtggctgagcggctggtgaagtttcacaacagcttccttgccaagtat
ggggagcccgagcagtga

DBGET integrated database retrieval system