KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_24164Help
Entry
COCSUDRAFT_24164  CDS       T02914                                 

Definition
(RefSeq) aromatic-aminoacid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00350  Tyrosine metabolism
csl00360  Phenylalanine metabolism
csl00380  Tryptophan metabolism
csl00950  Isoquinoline alkaloid biosynthesis
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    COCSUDRAFT_24164
   00360 Phenylalanine metabolism
    COCSUDRAFT_24164
   00380 Tryptophan metabolism
    COCSUDRAFT_24164
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    COCSUDRAFT_24164
   00950 Isoquinoline alkaloid biosynthesis
    COCSUDRAFT_24164
   00965 Betalain biosynthesis
    COCSUDRAFT_24164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csl04147]
    COCSUDRAFT_24164
Enzymes [BR:csl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     COCSUDRAFT_24164
    4.1.1.105  L-tryptophan decarboxylase
     COCSUDRAFT_24164
Exosome [BR:csl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCSUDRAFT_24164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase SepSecS Aminotran_5
Motif
Other DBs
NCBI-GeneID: 17040210
NCBI-ProteinID: XP_005646768
JGI: 24164
UniProt: I0YV05
AA seq 517 aa AA seqDB search
MPPHMNWPEFHASPPMAFTDVPGLQEGAVDDFEHSMGIEEFRKNAKDMVDWICDYYASNE
KLPVRSEVEPGYLRPLLPKAAPQHPENFGSIMQDVQSKIMPGITHWQSPNFFAYFPSNSS
FPAMLGDMLSTALSTVGFCWIGSPATTELETIVMDWLGKLLCLPTSFLAFDEQGKRGLGG
GVIQGSASESTLVSVLAARARVAPEHASKLVAYSSDQSHSSIKKACMVAGIPYVRIIPAS
AEDDYALDPAALREAIEEDLRNEDLIPFYVCATIGTTSSCAVDPIAEIGRITRHYNLWLH
VDAAYAGVTSMLPEYRHYFNGLELVDSFITNGHKWLLTNFDCSCMWVQNAEPLKTALSLT
PAYLRAKGNSLDYKDWQVPLGRRFRALKLWFVMRSYGTDNIKKFLRHHVQLGQLFVSLIQ
TDARLEIMAPPRWGLICFAIRGPNNDATNEATAELLERINKSGRAFLVHTELSGRFVARM
AIGGSLTQERHVRATWQLISECTTEVLAARAKFHKGV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcacatgaactggccggagttccatgcaagccctcccatggccttcactgac
gtcccaggacttcaggagggtgccgttgatgacttcgaacactctatgggaattgaggag
ttccggaagaatgccaaggacatggtggactggatttgtgactattacgcgtcaaacgag
aagctgcccgtgcgttcggaggtggagcctggctaccttcgtcccctcctacccaaggcc
gccccgcagcaccccgaaaacttcggctccatcatgcaggacgtccagtctaagattatg
ccaggcatcacgcactggcagagccccaacttcttcgcttacttcccctccaactccagc
ttccccgccatgctgggcgacatgctcagcaccgccctcagcaccgtcggcttctgctgg
atcggctccccagccaccacagagctcgagacgattgtgatggactggctgggcaagctg
ctgtgcctgcccacctccttcctggcctttgacgagcagggcaagcgcggcctcggaggc
ggcgtcatccagggctccgccagcgagtcgacacttgtgtcagtgctggctgcgcgcgcg
agggtcgcccctgagcacgcctcgaagctcgttgcgtacagctcagatcagtcgcacagc
tcaatcaagaaggcctgcatggtggcgggcatcccctacgtgcgcatcatcccagcctcg
gccgaggatgactacgcccttgacccggctgccctcagagaggcgatcgaagaggacctc
agaaatgaagacctgatccccttctacgtctgtgccaccatcggcacaacttcctcctgc
gcggttgacccaatcgctgagatcggccgcatcacccggcattacaacctctggctgcat
gtggacgcggcttatgcaggcgttacctccatgctgccagagtaccgccactacttcaac
ggcctggagcttgtggacagcttcatcaccaacgggcacaagtggctgctgaccaacttc
gactgctcctgcatgtgggtgcagaacgcggagcccctcaagacagcgctctcgctcacc
ccggcctacctgcgcgccaaggggaacagcctcgactacaaggactggcaagtgcctctg
ggccggcgcttccgcgcgctcaagttgtggtttgtgatgcgctcctacggcactgacaac
atcaagaaattcctcaggcatcacgtccagctggggcagctctttgtgagcctcatccag
accgacgcccgactggagatcatggcacccccacgctggggcctcatctgctttgctatc
agaggtcccaacaacgacgcgaccaacgaggcgactgcggagctgctggagagaataaac
aagagcggccgcgctttcctcgtgcacaccgagctgagcggtcgcttcgtggcgcgcatg
gcaatcggcggcagcctcactcaggagcgccacgtgcgtgccacctggcagctcatctcc
gagtgcaccaccgaggtcctcgctgcccgcgcgaaattccacaagggcgtctga

DBGET integrated database retrieval system