KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_26706Help
Entry
COCSUDRAFT_26706  CDS       T02914                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00220  Arginine biosynthesis
csl00250  Alanine, aspartate and glutamate metabolism
csl00260  Glycine, serine and threonine metabolism
csl00630  Glyoxylate and dicarboxylate metabolism
csl00710  Carbon fixation in photosynthetic organisms
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
csl01200  Carbon metabolism
csl01210  2-Oxocarboxylic acid metabolism
csl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    COCSUDRAFT_26706
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_26706
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_26706
   00260 Glycine, serine and threonine metabolism
    COCSUDRAFT_26706
   00220 Arginine biosynthesis
    COCSUDRAFT_26706
Enzymes [BR:csl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     COCSUDRAFT_26706
    2.6.1.4  glycine transaminase
     COCSUDRAFT_26706
    2.6.1.44  alanine---glyoxylate transaminase
     COCSUDRAFT_26706
Amino acid related enzymes [BR:csl01007]
 Aminotransferase (transaminase)
  Class I
   COCSUDRAFT_26706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 17045411
NCBI-ProteinID: XP_005651940
JGI: 26706
UniProt: I0Z9S7
AA seq 523 aa AA seqDB search
MSLRRGLEQRSALWALCRSVSVAAGGPLTQRTHGFASLPDPIGDDSPPQNSKNGKVLHPD
LLNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASP
ALLEHPEVGRLFPSDAIARAKQVLTYFPGGMGAYSDSRGAEGVRKEIAEFISKRDGYPSN
PNNIFLTDGASPAVRYILNAIIRSDKDGILVPVPQYPLYSASIQLYGGELVGYNLKEETG
WSMDIADVKKSVDDARARGIAVRALVFINPGNPTGQCLSYQNLEDIIKFAHEENIVLMAD
EVYQTNIFQDERPFVSCKKVMMDMGAPYSEQELVSFHTISKGALGECGMRGGMLEATNIH
PDTIDQLYKIASINLSPNTFGQAGLALMVNPPKEGDPSHEQHEAEAAGIIASMRRRARMM
TDGFNACEGITCNYTEGAMYSFPRLNLPPKALQAAKKAGKAPDTWYCLKLLDATGVLTVP
GSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKFHASFMDEYR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcgtcgtgggttggagcagcgcagtgcgctgtgggcgctttgccgttcagtg
tccgtcgctgcaggagggccattgactcagcgcactcacggcttcgcgtcgttaccagac
cccattggcgatgattctccaccacagaactcaaagaatggaaaggtcctgcatccagat
ctcctgaacgagaatctggtgcgcgctgaatatgccgtcaggggtgagttgtacctgagg
ggggaggagctgcgcaagcagggcaaagaaatcatctttacaaacgtgggaaacccgcac
gtcctgggccagaagcctctgaccttcaaccgccaggtgctgtcgcttattgcctcacca
gcgctgctggagcaccctgaggttggaaggctgttcccctcggatgcaatcgcgcgcgcc
aagcaggtgctcacctacttcccgggcggcatgggggcctacagcgactcccggggggcc
gagggggtgcgcaaggagatagcagagtttatctccaagcgggacggctatccttcaaac
cccaacaacatcttcctgactgatggcgcgtcgccggcggtacgctacattctcaatgcg
atcatacgcagcgacaaggacggtatcctggtgcccgtgccccagtacccgctctactct
gccagcatccagctctacggtggggagctggtggggtacaacctgaaggaggagaccggc
tggagcatggacattgcggacgtcaagaagagtgtggatgatgcgcgcgccaggggcatc
gccgtgcgcgctctggtcttcatcaaccctgggaacccgactgggcagtgcctgtcatac
cagaacctggaagacatcatcaagtttgcgcatgaggagaacattgtgctcatggcggac
gaggtgtaccagaccaacatcttccaggacgagcggccctttgtgagctgcaaaaaggtg
atgatggatatgggcgccccctacagcgagcaggagctggtgtccttccacacaatcagc
aagggcgcgctgggcgagtgcggcatgcgcggaggcatgctggaggcgaccaacatccac
cccgacaccatcgaccagctctacaagatcgcctccatcaacctgtcccccaacactttc
ggccaggctgggctggcgctgatggtgaacccaccgaaggagggcgacccgtcgcacgag
cagcacgaggcggaggcggcgggcatcattgcgagcatgcgccggcgcgcgcgcatgatg
accgacgggttcaacgcgtgcgagggcatcacctgcaactacaccgagggcgccatgtac
tccttcccgcgcctcaacctgccccccaaggcactgcaggcggccaagaaggccggcaag
gcgccggacacctggtactgcctcaagcttctggacgccaccggcgtgctgaccgtgccc
gggagcggatttgggcaggaggagggaacgttccacctgcgcaccaccattctaccgcaa
gaggacaagatcaaggatgtcattgccagcttccaaaagttccacgccagcttcatggac
gagtaccgctga

DBGET integrated database retrieval system