KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_30410Help
Entry
COCSUDRAFT_30410  CDS       T02914                                 

Definition
(RefSeq) glutathione peroxidase
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 17038670
NCBI-ProteinID: XP_005645235
JGI: 30410
UniProt: I0YQM2
AA seq 168 aa AA seqDB search
MTSALFGSTATAEAFYDFKVKDADGKTVDLSIYKGKVVLIVNVASQCGFTPQYKEMAELY
NKYSSQGFVILGFPCNQFGGQEPGSNAQVKKFAQDRGAKYPIMSKVDVNGSGEDPLFGFL
KAKQGGLLTKDIKWNFTKFLVDRQGNVIKRYGSSTTPLSIEDDIKGLL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacatccgctctttttggatcaaccgcgactgccgaggcgttctatgacttcaaggtc
aaggatgctgatggcaagacagtcgacctgtccatttacaagggcaaggtggtgctcatc
gtcaacgtggccagtcagtgcggtttcacgccccagtacaaagagatggcggagctttac
aacaagtacagcagccagggctttgtcattctcggcttcccctgcaaccagtttggcggg
caggagccgggcagcaatgcgcaggtaaagaaattcgcgcaggataggggcgcaaagtac
cccatcatgtccaaggttgacgtgaacggcagcggagaggacccgctgtttgggttcctg
aaggccaagcagggcgggctgctgaccaaggacatcaaatggaactttaccaagttcctg
gtggatcgacagggcaatgtcatcaagcggtatggcagttccacaacgccgctgtccatt
gaggatgacatcaagggcctgttgtga

DBGET integrated database retrieval system