KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_30844Help
Entry
COCSUDRAFT_30844  CDS       T02914                                 

Definition
(RefSeq) Nucleotidylyl transferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00760  Nicotinate and nicotinamide metabolism
csl01100  Metabolic pathways
Module
csl_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    COCSUDRAFT_30844
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     COCSUDRAFT_30844
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     COCSUDRAFT_30844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 17038259
NCBI-ProteinID: XP_005644827
JGI: 30844
UniProt: I0YPG4
AA seq 314 aa AA seqDB search
MFPALRRVSAATLAGFSCYHLCLSPAYYSAADTSCEGAVPGKVLQGLASPSEPSWLAWGR
SLLGVSQTSSLEVPTVLPTDKLTCKRRNHQPGTTYKPVVLLSCGSFNPPTYAHLRMFELA
AQELTKAGYDVLGGYMSPVHDAYSKKGLAPAEHRVAMCELAAGASPLIMVDSWEAAQKQY
QYSLHVLQHLERAVNDALDARHTRVRSMLLCGADMVESLTVPGVWRPEHVRHILQDHGLV
CIGRIHSDVRRLMEGSGSVLHEFAHNIVLVEDPIVNEISSTKIRSEMCQGHTVRYLLPDA
VVDYIQKNELYCSM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagcattgcgacgtgtttcagcagcaaccttagctgggttctcatgttatcat
ctctgtctatcgccagcatattacagcgcggcagatacctcatgcgaaggagctgtgcca
ggcaaagtccttcaggggcttgcttcgccttctgagccttcttggttggcatggggacgg
agcctccttggagtgtctcagactagttccctggaagtccccacagtgctgcccaccgac
aagcttacttgcaagagaaggaatcatcagcctggcaccacgtacaagccagtagtactg
ctttcctgtggcagtttcaaccctcctacctacgctcacctgcgcatgttcgagctcgct
gctcaggagctcacaaaggcagggtacgatgtgctgggcggctatatgtcccctgtacac
gatgcatacagcaagaaggggctcgcgccagctgagcaccgcgtggcgatgtgtgagctt
gcagcgggtgcatctcccttgatcatggttgactcctgggaagcagcccagaagcagtac
cagtacagcctgcatgtcctgcagcacctggagcgagcagtcaatgatgctctagatgca
aggcacacgagggtgcgcagcatgctgctgtgcggagcagacatggttgagagcctgaca
gtgccaggcgtgtggcgacctgagcacgtcagacacatcctgcaagaccacggtcttgtc
tgtataggcaggatacactcggatgtgaggcggctcatggagggttctggcagtgttctc
catgaattcgcgcacaatatagtactggtggaggatcccatagtcaatgagatcagctcc
acaaagatccgctctgagatgtgccagggacacactgttcgctatttactgcccgacgca
gttgttgattacatccagaagaatgaactgtattgttctatgtga

DBGET integrated database retrieval system