KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_31222Help
Entry
COCSUDRAFT_31222  CDS       T02914                                 

Definition
(RefSeq) succinate-CoA ligase beta chain
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00020  Citrate cycle (TCA cycle)
csl00640  Propanoate metabolism
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
csl01200  Carbon metabolism
Module
csl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSUDRAFT_31222
   00640 Propanoate metabolism
    COCSUDRAFT_31222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csl04147]
    COCSUDRAFT_31222
Enzymes [BR:csl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     COCSUDRAFT_31222
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     COCSUDRAFT_31222
Exosome [BR:csl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCSUDRAFT_31222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 17037329
NCBI-ProteinID: XP_005643933
JGI: 31222
UniProt: I0YLX0
AA seq 421 aa AA seqDB search
MLGSCLRALTRASQASRKNGMQLQHLRFLNVHEYQGAELMSQYGVNVPPGIPVFKLDEVL
PAAKKMADAEGQVVVKSQILAGGRGLGKFKSGLQGGVHICSVDEAPKLAEQMLGQVLVTK
QTGPAGKPVNTLYIANKMSFANEMYFAILLDRASAGPMIIACSEGGTSIEDLAEKYPEKI
IKITIDIFEGITDAQANQAVEALKVSGDKKAAADQIKALYETFVKSDCTMVEVNPLAETT
DGRLVAADAKLGFDDNAAFRQKELFAKRDSSQEDPREVAAGKFDLNYIGLDGNIGCMVNG
AGLAMATMDIIKLHGGSPANFLDVGGNASEQQVVEAFKILTSDPQVKAIMVNIFGGIMKC
DVIAAGIVNAAKGVGVSVPLIVRLEGTNVEKGKEILSNSDVDIIAADDLDDAATKAVKSI
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcttggatcttgcctccgggccctcaccagggcatcgcaggcatcgagaaagaatggc
atgcagctacaacacctgcggtttctcaatgtccacgagtatcagggcgctgagttgatg
agccaatacggggtcaatgttcctcctggcattccagtcttcaagctggatgaagtgctg
ccagcagcaaaaaagatggctgatgcagaaggccaggttgtggtgaagagtcagatcctg
gctggtggacgaggcttgggcaagttcaagagcggcttgcaaggcggggtgcacatctgc
agcgttgatgaggcacccaagctggcagagcagatgcttggacaggttcttgtcacaaag
cagactggcccagcggggaagcctgtcaacaccctgtacattgccaacaagatgagcttt
gcaaacgagatgtactttgcaatcctgctcgacagggcttctgcagggcccatgatcatt
gcatgcagcgaaggcgggactagcattgaggatctggcagagaagtacccagagaagatc
ataaagatcaccattgacatcttcgagggcattacagacgctcaggccaaccaagctgtg
gaggcactgaaggtcagtggtgacaagaaggcagcggcagaccagatcaaggctctctac
gagacctttgtgaagagcgactgcaccatggtcgaggtgaatcctctggctgagacgaca
gatggccgcctcgtggcagccgatgcgaagctgggcttcgatgacaacgcagccttcagg
cagaaggagctctttgccaagcgggactcgtcccaggaggaccccagggaggtggcggcg
ggcaagtttgatctgaactacatcgggctagacggcaacatcggctgcatggtcaacggt
gctggcctggccatggcgaccatggacatcatcaagctgcatggcggatcccccgccaac
ttcctggacgtgggaggcaatgcctccgagcagcaggtggtggaggcattcaaaatcctc
acatcagacccccaagtcaaggccatcatggtcaacatctttggtggcatcatgaagtgc
gatgtcatcgctgctggcatcgtcaacgcagcaaagggggtgggcgtgtcagttcccctg
atagtgaggttagagggcaccaatgtggagaagggcaaggagatcctgagcaacagcgat
gtggacatcatagcagctgatgacctggacgatgctgcaaccaaggcagtcaagtccatc
caatga

DBGET integrated database retrieval system