KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_33371Help
Entry
COCSUDRAFT_33371  CDS       T02914                                 

Definition
(RefSeq) S-adenosyl-L-methionine-dependent methyltransferase
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00130  Ubiquinone and other terpenoid-quinone biosynthesis
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
Module
csl_M00112  Tocopherol/tocotorienol biosynthesis
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    COCSUDRAFT_33371
Enzymes [BR:csl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol O-methyltransferase
     COCSUDRAFT_33371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 CMAS Methyltransf_12 Ubie_methyltran Methyltransf_2 MetW DOT1 MTS PCMT Methyltransf_24 NAS
Motif
Other DBs
NCBI-GeneID: 17040706
NCBI-ProteinID: XP_005647263
JGI: 33371
UniProt: I0YWF0
AA seq 261 aa AA seqDB search
MWGEHMHHGYYPQGGPKKSNQEAQIDMIEEVLSWAGVTEASKMVDVGCGIGGSSRHIARK
FGCSAKGITLSPVQAGRANALAEQQGLADRVSFQVADALQQPFPDASFDLIWSLESGEHM
PDKERFVGELARVCAPGGHIIIVTWCHRNLEEGETGLKPNEKSLLDLICKAYYLPQWCSL
NDYRRIFEAQGLQDIKTADWSEEVAPFWGAVIRSALSTDGFTGLFKAGWSTIKGALVMPL
MARGFSIGLVKFNLITARKAK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcgagcacatgcaccacggctactatccacaaggcggacccaagaagagcaat
caggaagcgcagatagacatgatcgaagaagtcttgagttgggcaggcgtcacagaagca
tccaagatggtggatgttggctgcggcatcggcggcagcagtcggcacattgccaggaaa
tttgggtgctcagcaaagggcattaccctcagccctgtgcaggctgggagggcgaatgct
ttggcagagcagcagggcctggcggaccgtgtttcgttccaggtggcagacgcgctgcag
cagcccttcccagacgcctcttttgacctgatatggagcctggagagtggggagcacatg
cccgacaaggagcgctttgttggcgagctggcgcgcgtttgtgctcctgggggccatatc
atcatagtcacctggtgccacaggaacctggaggagggagagacagggctgaagccgaac
gagaagtccctgctcgacctcatctgcaaagcctactacctaccgcagtggtgttccctt
aatgactaccgccgcatatttgaggcgcagggcttgcaggatattaagacagctgactgg
tctgaggaggtggcgccattctggggcgctgtcattcgctctgcactcagcactgacggc
ttcacaggcctgtttaaggctggatggtccactatcaagggtgctctggtcatgcccctt
atggctcgcggcttctccattggccttgtgaagttcaacttgatcactgcccgcaaagca
aaatga

DBGET integrated database retrieval system