KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_39119Help
Entry
COCSUDRAFT_39119  CDS       T02914                                 

Definition
(RefSeq) acyl-CoA N-acyltransferase
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     COCSUDRAFT_39119
Chromosome and associated proteins [BR:csl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    COCSUDRAFT_39119
   HAT complexes
    HATB complex
     COCSUDRAFT_39119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_7 Acetyltransf_CG Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 17045468
NCBI-ProteinID: XP_005651997
JGI: 39119
UniProt: I0Z9Y4
AA seq 395 aa AA seqDB search
MCHQFFGDEEVIKGYEDLEIDIWLSQRSFEALLEVRYSSKMQDADDIEKAMRDKFTDGLS
TTRQEYLTKLQGAAPLLLESLGKPVLEFGPERGSLAVYRDLHARLQPLLMFFVDGASFID
PEEPEWDLLLALHTDAGVVTVSGFATIYTFWCYPNQTRIRVSQVLVPPPNQGEGVGRALL
EAAYITADERGAVDITYEDPTDTVQLIRERVELQRAVKLPWLADLAASTAKALGGSPTAA
ASSNGATPPEANGAEAPVSPMLQPKDQARAQADLRITRKQVRKLWEVLLSAQPGWGEALR
QATVEGLVRARLVGGVTSTKRVAEGKRIFETEAGFHMTRVPAGSGMGPGSGMPVAMERDD
VEGESAEEREAALEEAVTKRMDELSALVAYVQRLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtgccatcagttctttggggacgaggaggtgatcaagggctatgaggacctggagatt
gatatctggctcagccagaggagctttgaggcattgctcgaggtgcgctacagcagcaag
atgcaggatgcagacgacatcgagaaggccatgcgagacaagttcacggacggactctca
accacacgtcaggaatacctgaccaaacttcagggcgcagctccgctcctccttgaaagc
ttgggcaagccggtcctggaatttggcccagagaggggcagcctggctgtgtacagggac
ctgcatgcacgcctgcagccgctgctcatgttctttgtggacggcgccagtttcatcgac
ccggaggagccagagtgggacctgctccttgcacttcacactgatgccggcgttgtgacc
gtttcgggatttgcgactatctacaccttctggtgctacccgaaccagacgcgcatccgg
gtgtcacaagtgctcgtgccgcccccgaaccagggcgagggcgtgggcagggccctgctc
gaggccgcctacatcacagccgacgagaggggcgctgtcgatatcacgtatgaggatccc
acggacacagtgcagttgatcagggagcgcgttgagctgcagcgggcagtcaaactcccc
tggcttgctgacctggccgccagcactgccaaagccttaggtggctccccaacagccgcc
gcgagctctaacggtgccacacctcctgaggctaatggtgcagaggcacccgtctcacca
atgctacagccgaaggatcaggccagggcgcaggccgacctgcgcatcaccaggaaacag
gtgaggaagctgtgggaggtgctgctgagcgcgcagccgggctggggcgaggcgctgcgg
caggccacggtggagggcctggtgcgcgcgcgtctggtcgggggcgtcacctccaccaag
cgcgtggccgagggcaagcgcatcttcgaaaccgaggccggcttccacatgaccagggtg
ccggcagggagcgggatggggccggggtcggggatgccggtggcgatggagcgggatgac
gtggagggagagagcgccgaagagcgcgaggcagcccttgaggaagccgtgactaagcgc
atggatgagctcagcgcccttgtggcctacgtgcagcgcctgctataa

DBGET integrated database retrieval system