KEGG   Campylobacter subantarcticus LMG 24374: CSUB8521_0075Help
Entry
CSUB8521_0075     CDS       T03571                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
csm  Campylobacter subantarcticus LMG 24374
Pathway
csm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:csm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CSUB8521_0075 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:csm03011]
    CSUB8521_0075 (rplV)
Ribosome [BR:csm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CSUB8521_0075 (rplV)
  Bacteria
    CSUB8521_0075 (rplV)
  Archaea
    CSUB8521_0075 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJC89976
UniProt: A0A0A8H7F4
Position
66815..67189
Genome map
AA seq 124 aa AA seqDB search
MSRALIKFIRLSPTKARLIAREVQGMNAELALASLKFMPNKGAKFIANAISSAVANGGFE
ANEVVVSSCRVDAGAVLKRFRPRARGSASRIRKPTSHILVEVSKVEASAEKTTKAKKASV
KKES
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagcattaattaaattcataagattatctccaactaaagcgagattgattgct
agagaagttcaaggtatgaatgcagagcttgcattagctagtttgaaatttatgccaaat
aaaggtgctaaatttatagcaaatgctatttcaagtgctgtagcaaatggcggatttgaa
gcaaatgaagttgttgtttcaagttgtcgtgttgatgctggtgcggttttaaaaagattt
agaccaagagctagaggaagtgctagtcgtattagaaagccaacttcacacattttggta
gaagttagtaaagtagaagcaagtgctgaaaaaactacaaaagctaaaaaagcatcagtg
aaaaaggaaagctaa

DBGET integrated database retrieval system