KEGG   Campylobacter subantarcticus LMG 24374: CSUB8521_0611Help
Entry
CSUB8521_0611     CDS       T03571                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase, proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
csm  Campylobacter subantarcticus LMG 24374
Pathway
csm00564  Glycerophospholipid metabolism
csm01100  Metabolic pathways
csm01110  Biosynthesis of secondary metabolites
Module
csm_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:csm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CSUB8521_0611 (psd)
Enzymes [BR:csm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CSUB8521_0611 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AJC90467
UniProt: A0A0A8H950
Position
588399..589208
Genome map
AA seq 269 aa AA seqDB search
MGFSNSASKMFGIIAKYKFPKIIQKNINKAYVNAFNINMSEFKPLEEYESLNALFTRTLL
NERELEDGFISPSDGKILELGSSFQNDLKENLALSIKGSSYSIEELLKNSASKEELKNGI
DYTNIYLSPKDYHHYHAPCNMQILSATYMSGALFSVSEAKLAKIINLYTKNERVVLKCLV
DGKFILWMVFVGALNVGKMHFTFDTSIQTNAANFDFTHTYEDLFVKKGQRLGNFELGSTI
VLIAQKGLLKFSKHAYEQVEFSKKIADLV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgggatttagtaatagtgcttcaaaaatgtttggaatcatagcaaaatataaatttcca
aaaattatacaaaaaaatattaataaagcttatgtaaatgcttttaatattaatatgagt
gaatttaaacctttagaagaatatgagagtttaaatgctttatttacaagaactttgtta
aacgagcgagagttagaagatggatttataagtccaagtgatggtaaaattttagaactt
ggaagtagttttcaaaatgatttaaaagaaaatttagctttgagtattaaaggttcaagt
tatagcatagaagaacttttgaaaaattcagccagcaaagaagaattaaaaaatggcata
gattatacaaatatttatttatctccaaaagattatcatcattatcatgcaccttgtaat
atgcaaattttaagtgctacttatatgagtggggctttatttagtgtgagtgaggcaaag
ttagcaaagattataaatctttataccaaaaatgaaagagtagttttaaagtgtttggta
gatggaaaatttatactttggatggtatttgtgggtgcgctaaatgtaggtaaaatgcat
tttacatttgacactagtatacaaactaatgctgcaaattttgattttactcatacttat
gaggatctttttgtaaaaaaaggtcaaaggcttggaaattttgagctaggttcaactata
gttttaatcgctcaaaaaggacttttgaaatttagtaaacatgcttatgagcaggttgaa
ttttctaagaagatcgcggatcttgtttag

DBGET integrated database retrieval system