KEGG   Campylobacter subantarcticus LMG 24374: CSUB8521_0770Help
Entry
CSUB8521_0770     CDS       T03571                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
csm  Campylobacter subantarcticus LMG 24374
Pathway
csm00010  Glycolysis / Gluconeogenesis
csm00030  Pentose phosphate pathway
csm00051  Fructose and mannose metabolism
csm00680  Methane metabolism
csm01100  Metabolic pathways
csm01110  Biosynthesis of secondary metabolites
csm01120  Microbial metabolism in diverse environments
csm01130  Biosynthesis of antibiotics
csm01200  Carbon metabolism
Module
csm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSUB8521_0770 (fbp)
   00030 Pentose phosphate pathway
    CSUB8521_0770 (fbp)
   00051 Fructose and mannose metabolism
    CSUB8521_0770 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    CSUB8521_0770 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csm04147]
    CSUB8521_0770 (fbp)
Enzymes [BR:csm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CSUB8521_0770 (fbp)
Exosome [BR:csm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CSUB8521_0770 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: AJC90619
UniProt: A0A0A8HCJ2
Position
756329..757177
Genome map
AA seq 282 aa AA seqDB search
MQEIINDIQKAVIEISHELRYLKDFDYTSSQNATGDNQLKLDVKSDEIITRVLKQSKGIK
SLISEEKQEQLLINENEKYIIAYDPLDGSSLVDVNFAIGSIFAIYEHEASAKNLKAAVYA
IYGVRLELIVCMDTPKLYRLNENNEFVYVKELKLSEKGKLNASGGTQKNWSSTHRDFIKT
LFDEGYRLRYSGAMVSDLHQILLKGGGLFSYPATTDALNGKLRAYFEVFPFAFIFEKAGG
FSTNGVNDSLLELEFDKIHASTPCFLGSKYEIEKLKQAYKGL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagattatcaatgatatacaaaaggctgtgattgaaatttctcatgagcttaga
tatttaaaagattttgattatacaagttctcaaaatgccacaggagataaccagcttaag
cttgatgttaaaagtgatgaaattattactcgtgttttaaaacaaagtaaaggtattaaa
agcttaattagtgaagaaaaacaagagcaattactcatcaatgaaaatgaaaaatacatc
atagcttatgatccgttagatggttcgtctttggttgatgtaaatttcgctataggatca
atttttgccatttatgagcatgaagcgagcgctaagaatttaaaagcggctgtttatgcg
atttatggcgtgcgtttagagttgatagtttgcatggatacccctaaactttatagactt
aatgaaaataatgaatttgtttatgtgaaagagttaaaactcagcgaaaagggcaaacta
aatgcaagtggtggaacacaaaaaaactggtctagtacacatagagacttcattaagact
ttgtttgatgagggctatcgtttaagatattcaggtgcaatggtgagtgatttacatcaa
attttactcaaaggcggaggtttgttttcatatcctgcaactactgatgcactcaatgga
aaattaagagcttattttgaagtgtttccttttgcatttatatttgaaaaagcaggggga
ttttctaccaatggtgtaaatgattctttgctggaattagaatttgataaaattcatgca
agcacaccatgctttttgggttcaaaatatgaaattgaaaaattaaaacaagcgtataaa
ggactttga

DBGET integrated database retrieval system