KEGG   Campylobacter subantarcticus LMG 24374: CSUB8521_0772Help
Entry
CSUB8521_0772     CDS       T03571                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csm  Campylobacter subantarcticus LMG 24374
Pathway
csm00450  Selenocompound metabolism
csm00970  Aminoacyl-tRNA biosynthesis
csm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CSUB8521_0772 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSUB8521_0772 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csm01007]
    CSUB8521_0772 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csm03016]
    CSUB8521_0772 (metS)
Enzymes [BR:csm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CSUB8521_0772 (metS)
Amino acid related enzymes [BR:csm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CSUB8521_0772 (metS)
Transfer RNA biogenesis [BR:csm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CSUB8521_0772 (metS)
 Prokaryotic type
   Other AARSs
    CSUB8521_0772 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Zn_Tnp_IS91 zinc-ribbons_6 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AJC90621
UniProt: A0A0A8H963
Position
757386..759260
Genome map
AA seq 624 aa AA seqDB search
MRYITTPIYYVNDVAHIGHAYTTIIADTLARFYRLQGQKTFFLTGTDEHGQKIEQAASAR
NFTPKEYADEISAKFKKLWDEFEISYDYFIRTTDENHKLSVQKAFKKMFDKGDIYKGTYE
GFYCVSCESYFTQTQLVNECHCPDCGKKTQLLKEESYFFKLSKYQDQILKWYKEKEPILP
KNKANELIHFVEGGLKDLSITRTSFEWGIKLPKELNDEEHVVYVWLDALMNYVSALGYGL
DEKNMDLWPAHIHFVGKDILRFHAVYWPAFLMSLELPLPQFIAAHGWWTKDGEKMSKSKG
NVVAPKEVADAFGLEAFRYFLLREVPFGNDGDFSQKALITRINAELSNELGNLLNRIIGM
SAKYSQNVIDSKDVSLYFTQELHECKKYLDHAINALEGIQPNRYLEELFKALSLANLCIS
KYEPWNLIKNNETQKANALVALCANILAKVAILLYAAMPKTALKIAKALNFEISNENYQK
LILNYQLCDLKSSTCEALFPKVEFMQEEKKEVTPSLAQIKIDDFKKIEIKVALVKDCQNI
EGSEKLLKFQLELENGELRQVLSGIAKFYKASELVGKQVCMITNLKKAKIFGHESQGMIL
SAEKDGKLVLISPQSFIENGALIG
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattactactcctatatattatgtaaacgatgtagcacacataggccatgct
tatactacaatcatagctgacactttggcgagattttatcgcttgcaaggtcagaaaact
ttttttcttacaggaactgatgagcatggtcaaaagatagaacaagctgctagtgctaga
aatttcactcctaaagaatatgcagatgagattagtgctaaatttaaaaaattatgggat
gagtttgaaatttcttatgattatttcatcagaactacagatgaaaaccacaaattaagt
gtacaaaaagcatttaaaaaaatgtttgataaaggtgatatttataaaggtacatatgag
ggtttttattgtgtttcttgtgagagttattttacccaaactcagcttgtaaatgagtgc
cattgtccagattgtggtaaaaaaacacaactgctgaaagaagaaagttactttttcaag
ctttctaaatatcaagatcaaattcttaaatggtataaagaaaaagagccaattttacct
aaaaataaagccaatgaattaattcactttgttgaaggaggattaaaagatctttccatt
acaagaacgagttttgaatgggggataaaacttccaaaagaactaaatgatgaagaacat
gtggtgtatgtttggcttgatgctttgatgaattatgtgagtgctttgggctatggactt
gatgaaaaaaatatggatctttggcctgctcatattcattttgtaggtaaggatatcttg
cgttttcatgcggtatattggccagcatttttgatgagtttggaacttcctttacctcaa
tttattgcagcgcatggttggtggactaaagatggtgaaaaaatgagtaaatctaaaggc
aatgtggtagcacctaaagaagtggctgatgcttttggtttagaagcttttaggtatttt
ttacttagagaagttccttttggcaatgatggggatttttcacaaaaagcattgattact
agaattaatgcggagttaagtaatgaacttggaaatttgttaaatagaattatcggtatg
agtgctaaatattcccaaaatgtgattgattctaaagatgtgagtttgtattttactcag
gagttacatgagtgtaaaaagtatttagatcatgcaattaatgccttagagggtattcaa
ccaaatcgctatctagaagagctttttaaggctttgtcattagcaaatttatgtattagt
aagtatgagccttggaatttaattaaaaataacgaaactcaaaaagctaatgctttggta
gctctatgtgctaatattttagcaaaggtagctattttactttatgcggctatgccaaaa
acagcgttaaaaattgcaaaagctttaaattttgaaatttcaaatgaaaattatcaaaaa
ttaattttaaactatcaattatgcgatctaaaatctagtacatgtgaagctctatttcca
aaagtagaatttatgcaagaagaaaaaaaagaagttacaccgagtttagctcagattaaa
attgatgattttaaaaaaatcgaaatcaaggtagccttggtaaaagattgtcaaaatatc
gaaggaagtgaaaagcttttaaaatttcaacttgagcttgaaaatggcgaactaagacaa
gtgctttcgggtattgctaaattttataaggcaagtgagttagttggtaaacaagtttgc
atgatcactaatttaaaaaaggctaaaatttttggacacgaaagccaaggtatgatttta
agtgcagaaaaagatggaaaattggttttaattagtccgcaaagttttattgaaaatgga
gctttaataggctag

DBGET integrated database retrieval system