KEGG   Cyanobacterium stanieri: Cyast_1305Help
Entry
Cyast_1305        CDS       T02377                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00030  Pentose phosphate pathway
csn00480  Glutathione metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01200  Carbon metabolism
Module
csn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
csn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyast_1305
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyast_1305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csn04147]
    Cyast_1305
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cyast_1305
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cyast_1305
Exosome [BR:csn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cyast_1305
  Exosomal proteins of colorectal cancer cells
   Cyast_1305
  Exosomal proteins of bladder cancer cells
   Cyast_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AFZ47270
UniProt: K9YLJ4
Position
1440226..1441755
Genome map
AA seq 509 aa AA seqDB search
MVTLQENPLRAGLKQAKTPEPLILTIFGASGDLTQRKLVPALYQLKKEGRLPGEMTIVGV
ARREWSHDYFREQMRQGIEEFSDGIANEELWNDFAEGLYYCPGNMDEPESYDKLKNFLEE
LDGKRGTRGNRVFYLAVSPQFFPPAIKQLGAAGMLKDPLKHRLVIEKPFGKDLSSAQVLN
RIVQKVCREEQIYRIDHYLGKETVQNLMVFRFANAIFEPLWNRNYVDNIQITVAETVGVE
ERAGYYESAGALRDMVQNHLLQLFCLTAMEAPNGINADSIRGEKVKVLQSTRLADIKNLE
KSAIRGQYTAGWMKGKPVPGYREESGVSPESTTPTFVALKLMIDNWRWQGVPFYLRTGKR
LPKKVSEIAIQFKNVPLTIFPSAAQQTNPNILALRIQPNEGISLRFEAKVPGAELRTRTV
DMDFSYGSSFGVATADAYHRLLLDCMLGDQTLFTRADEVEEAWRIVTPALTAWDAPSAPD
SVPFYEAGTWQPPEAEFLLNRDGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggttacactacaagaaaaccccttaagagcgggtttaaaacaagctaaaactccagag
cctcttattctgacaattttcggggcttcaggagacttgacccaaagaaaattagtacct
gccttatatcaattaaaaaaagagggtagattaccgggtgagatgaccattgttggagtg
gcacgacgggaatggagtcatgattatttccgtgagcaaatgcgacaaggcattgaggag
ttttccgatggcattgccaatgaggaattatggaatgattttgccgagggtttatattac
tgccctggtaatatggatgagcctgaaagttatgataaattgaagaattttctggaggag
ttggacggcaaaagaggaactaggggaaacagagtcttttatttggcagtatcaccccaa
ttttttccccctgccatcaagcaattgggcgccgcagggatgttaaaagatcccctaaaa
catcgtttagtgattgaaaagccctttggaaaagacttgagcagtgcgcaggtgttgaac
cgcattgtccagaaagtctgtcgagaggaacaaatataccgcattgatcattatcttggt
aaggagacggtgcaaaatttgatggtgtttaggtttgctaatgccatttttgagccgtta
tggaatcgtaattatgtggataatattcaaatcaccgtggcggaaaccgttggggtagaa
gaaagggcaggttattatgagtcagcaggggcgctgcgggatatggtgcaaaatcacctc
ttacagttattctgtttaacagctatggaagcgcccaacggtattaatgccgatagcatt
aggggagaaaaggtgaaggttttacaatctacccgcctagctgatattaaaaatttggaa
aaaagtgccattcggggacaatacaccgcaggatggatgaaaggaaaacccgtgccgggt
tatcgggaagagagtggggttagtcctgaatccactactcctacttttgtggcattaaaa
ttgatgattgataattggcgttggcagggtgtgcctttttacctacgtacaggaaaacgt
ttaccgaaaaaggtttctgagattgccattcagtttaaaaatgtacctctaactattttc
ccctcggcggcacaacaaaccaacccgaatattttggcattgaggattcagcctaatgaa
ggtatttccctacgctttgaggcgaaggtgccgggggcagaattacgcacccgtacggtg
gatatggattttagttatggttcttcttttggggtggcgacggcggatgcctatcatcgt
ctgttattagattgtatgttaggggatcaaactttgtttacccgtgccgatgaggtggaa
gaggcttggcggattgttacccctgcgctgacggcttgggatgctccttctgctcctgat
tcggtgcctttttatgaggcgggtacatggcaacctcccgaggcggaatttttacttaac
cgtgatggcagaagatggcgccgtttgtaa

DBGET integrated database retrieval system