KEGG   Cyanobacterium stanieri: Cyast_2700Help
Entry
Cyast_2700        CDS       T02377                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:csn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cyast_2700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csn01007]
    Cyast_2700
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csn03016]
    Cyast_2700
   03029 Mitochondrial biogenesis [BR:csn03029]
    Cyast_2700
Enzymes [BR:csn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Cyast_2700
Amino acid related enzymes [BR:csn01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Cyast_2700
Transfer RNA biogenesis [BR:csn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cyast_2700
 Prokaryotic Type
   Other AARSs
    Cyast_2700
Mitochondrial biogenesis [BR:csn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cyast_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Syd
Motif
Other DBs
NCBI-ProteinID: AFZ48643
UniProt: K9YRC0
Position
2960347..2962095
Genome map
AA seq 582 aa AA seqDB search
MIDTLRQIFATALKQTFGNDVTFVEPLVVPATNPRFGDYQCNVALPLAKQLKDNPRAIAQ
RIVDNINLDEFCQPLEIAGPGFINITIKPEYIAQQITTAHQDERLGVTAITPEGKTVIDF
SSPNIAKEMHVGHLRSTIIGDSIARILEFRGHNVLRLNHVGDWGTQFGMLIAFLRQEKPE
VLTTANAVAIGDLVTLYKQAKSKFDQDPEFKEEARQEVVKLQSKDSESIKAWQLLCEQSR
KEFQIIYDLLDIELTERGESFYNPFLPAIINLLEEENLLVEDQGAKCVFLDNFVNKQGDP
LPLIVQKSDGGYNYATTDLACLKYRIEEDKATKIIYVTDAGQSNHFTQVFQVAQKANIVP
ENVELVHVPFGLVLAEDGKKIKTRSGETIRLKDLLDEAINRAKKDLENRLESEGRNEDES
FINHVSQVVGLSAVKYADLSQNRTTDYKFSFDKMLALQGNTAPYLLYAYVRVQGISRKGN
IDLDNLEINKSIIIKEESELVLAKHLLQLDYVIKEVEKDLLPNRLCLYLFELSQKFNQFY
DQCPILQAEEDVKLSRLILADLTAKVIKLGLSLLGISVLERM
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgattgatactcttagacaaatttttgccactgctctaaaacaaacctttgggaatgat
gttacttttgttgagcctttggttgtacctgctaccaatcctcgatttggggattatcag
tgtaatgtcgctcttccccttgctaaacagttaaaagataatccaagggcgatcgcccag
cgcatagttgataatattaacttagatgaattttgtcaacccctcgaaattgccgggcca
ggatttatcaacatcaccatcaaacctgaatatatcgcccaacaaatcaccacggcccat
caagatgagcgtttaggggtaacagcaattacacccgaaggaaaaaccgtcatcgatttt
tctagccccaatattgccaaggaaatgcacgtagggcatctacgctcaaccattatcggt
gatagtatcgcccgaattttagaatttagagggcataatgtcctccgactcaaccatgta
ggggattggggtactcaatttggaatgttaatcgcctttttgcgacaagagaaaccagaa
gttttaaccacggctaatgctgtggctattggcgatttagtaaccttatataaacaggca
aaatcaaagtttgatcaagatccagaatttaaagaagaagcccgtcaagaagtagtaaaa
ctgcaaagtaaagattcagaaagtatcaaagcatggcaactactttgtgagcaatcaagg
aaagagtttcaaattatttatgaccttttagacatcgaattaactgaaaggggagagtct
ttttataatccttttttacctgctattattaatcttttagaagaggaaaatttattagtt
gaagatcaaggagctaaatgtgtttttcttgataattttgtgaataaacagggagatcct
ttacctctcattgtgcaaaaatctgatggtggttataactatgctactactgatctagct
tgtttaaaatatcgcatcgaagaagacaaagcgactaaaattatttatgtaacagacgca
ggacaaagtaaccattttacccaagtttttcaagtagcccaaaaagctaatattgttcct
gaaaatgtcgaattagtccatgttccttttggtttagttttggcggaagatggtaaaaaa
attaaaacaagatctggagaaactatccgtttaaaagacttgttagatgaagccattaat
cgagccaaaaaagatttagaaaatcgtctcgaaagtgagggcagaaatgaggatgaaagt
tttattaatcatgttagtcaagtggttggtttaagtgctgtaaaatatgctgatttaagt
caaaatcgtaccactgattataaatttagttttgataaaatgttagctttacagggcaac
actgctccttatcttttgtatgcttatgttagggtgcaggggattagtcgtaagggtaat
attgatttggataatttggaaataaataaatccattatcattaaggaagaaagtgagtta
gttttagcaaaacatcttttacaattagattatgttattaaggaagtagaaaaagattta
ttacctaatagactttgtttatatctgtttgaattaagtcaaaagtttaatcaattttat
gatcagtgtcctattttacaggcagaggaagatgttaagttatcccgtttaattttggct
gatttgacagcaaaagtgattaagttaggtttatctttattgggaatttctgtattagaa
agaatgtag

DBGET integrated database retrieval system