KEGG   Clostridium cf. saccharolyticum K10: CLS_12830Help
Entry
CLS_12830         CDS       T02614                                 

Definition
(GenBank) dihydroxyacetone kinase DhaK subunit
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
cso00561  Glycerolipid metabolism
cso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CLS_12830
Enzymes [BR:cso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     CLS_12830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1
Motif
Other DBs
NCBI-ProteinID: CBK76931
UniProt: D6DGV7
Position
1236834..1237823
Genome map
AA seq 329 aa AA seqDB search
MKKIINSVEQVENEMVLGMAKAYPQYVRKLDCGNVVVRAHKKEGKVALISGGGSGHEPAH
GGYVGEGMLDAAVSGAVFTSPTPDQIFEGIKAVATDKGVLMVIKNYTGDVMNFEMAGEMA
QMEGIKVAQVVVNDDVAVKDSLYTVGRRGVAGTVFVHKIAGAKAETGASLEEVQAVAQKV
IDNVRTMGMAIRPCTVPAAGQPGFELRDDEMEVGIGIHGEPGTHREPLKKADEIVDLLLD
KILADLDYSGKEVAVMINGAGATPLMELFIVNNHLSDVLAEKGIKVYKTLVGEYMTSIEM
EGFSISLLRLDDELKELLDAKADTPAFKA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattatcaacagtgtggagcaggtggagaatgagatggtccttggcatggct
aaggcttacccgcagtacgtgagaaagctggactgcggcaatgtggtggtgcgcgctcac
aagaaggagggcaaggtagccctgatcagcggcggcggcagcggccatgagccggctcac
ggcggatatgtgggagagggaatgctggatgcggctgtctccggcgctgttttcacttca
ccgacgccagaccagatttttgagggaatcaaggctgtcgctacggacaagggcgtgctt
atggtaatcaagaattacaccggagatgtgatgaatttcgagatggccggagagatggct
cagatggagggaatcaaggtagcccaggttgttgtaaatgatgacgtggcagtaaaggac
agcctctatacagtgggacgaagaggcgtggccggcactgtgttcgtgcataagatcgca
ggtgccaaggctgagactggggcttcccttgaggaagtgcaggcagtggctcagaaggtg
atcgacaatgtgagaaccatgggcatggcaatccgtccctgcacggttccggcagcaggc
cagccgggcttcgaactgagagatgacgagatggaggtgggaatcggcatccacggtgag
ccgggaacccacagagagccattgaagaaggcagatgagatcgtggatctgcttctcgac
aagattctggcagatctggactacagcgggaaagaggtagctgtgatgattaacggcgca
ggagcaaccccgctgatggagctgttcattgtaaataaccatctctcagacgttctggca
gaaaaaggcattaaggtgtataagacactggtaggcgagtacatgacatccatcgagatg
gagggcttctccatttccctgttaaggctggatgacgagttaaaggaactgctggacgcc
aaggcagacacgccggctttcaaggcataa

DBGET integrated database retrieval system