KEGG   Clostridium cf. saccharolyticum K10: CLS_22690Help
Entry
CLS_22690         CDS       T02614                                 

Definition
(GenBank) Pyruvate/oxaloacetate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
cso00620  Pyruvate metabolism
cso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLS_22690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cso02000]
    CLS_22690
Enzymes [BR:cso01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CLS_22690
Transporters [BR:cso02000]
 Other transporters
  Primary active transporters [TC:3]
   CLS_22690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like DUF4868
Motif
Other DBs
NCBI-ProteinID: CBK77704
UniProt: D6DJ30
Position
2173813..2175225
Genome map
AA seq 470 aa AA seqDB search
MAKIEKKPVKIVETVLRDAHQSLIATRMTTEQMLPIIDKMDKVGYHAVECWGGATFDASL
RFLKEDPWERLRKLRAGFKNTKLQMLFRGQNILGYNHYADDVVEYFVQKSIANGIDIIRI
FDCLNDIRNLKTAVKAANKEKGHAQVALSYTLGDAYTLDYWKNIAKEIEDMGADSLCIKD
MAGLLTPYAAEELVTALKESTKLPIDLHTHYTSGVASMTYLKAVESGCDIIDTAISPFAL
GTSQPATEVMVETFSNTPYDTGLNKEALAEIADYFRPMREEALKSGLMNTKVLGVDINTL
RYQVPGGMLSNLVSQLKEAHAEDKYYDVLQEIPRVRKDFGEPPLVTPSSQIVGTQAVLNV
LMGERYKMFTKESKKLLMGEFGQTVKPFNPEVQKKAIGKAEPITCRPADLIEPQLKKLES
EMSQWKTQDEDVLTYALFPQVAKEFFEYREAQKTGVDPKAADRANKAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatagagaaaaagccggtcaagattgtggaaactgtcctgcgtgacgcccac
cagtctctgatcgccactaggatgacaacagagcagatgcttcccatcatcgacaagatg
gataaggtggggtatcatgcagtggagtgctggggaggagctaccttcgatgcttccctc
cgtttcctgaaagaagatccgtgggagagactgcgcaagctgagagccggatttaaaaac
acgaagctccagatgcttttccgcggacagaatattttgggctacaaccactatgctgac
gatgtggtagagtactttgtgcagaagtccattgcaaacggaattgacattatccgtatt
ttcgactgcttaaatgatatcaggaacttaaagacagcggttaaagcagctaataaggag
aagggacatgcacaggtagccctttcttatacgctgggagatgcctataccctggattac
tggaagaacattgccaaagagatcgaggatatgggagcagattctctgtgtatcaaggat
atggcaggccttctgactccttatgcggcagaggagctggtaacagcactcaaggagtct
acaaagcttccgattgatctgcacactcactatacatccggtgtggcatccatgacttat
ttaaaggcagtagagtcaggatgcgacattattgacacagctatctcaccgttcgctctc
ggaaccagccagccggctaccgaggtgatggtggaaaccttcagcaatactccatatgat
acaggactcaataaagaggccctggcagagatcgctgattacttccgcccaatgcgtgag
gaagccttaaagagcggacttatgaatacaaaggtgctcggtgtggatatcaacacgctg
cgctatcaggttccgggaggaatgctgtccaacctggtttctcagcttaaggaggctcat
gcagaggacaaatactatgacgtgctgcaggaaattccgagagtgaggaaggatttcgga
gagccgccgcttgtaaccccgtcttctcagattgtgggaacacaggctgtgttgaatgtg
ctgatgggagagagatataagatgtttacgaaggaatccaaaaagctcctgatgggagaa
tttggacagaccgtaaagccatttaacccggaggttcagaagaaagccattggcaaggca
gagccgattacctgccggccggcagatctgattgagccgcagctgaaaaagctggagtct
gagatgtcccagtggaagacacaggatgaggatgtgctgacatacgctctgttccctcag
gtggcaaaggaattctttgagtacagagaggctcagaagacaggcgttgatccgaaggct
gctgaccgcgcaaacaaggcttaccctgtataa

DBGET integrated database retrieval system