KEGG   Ceratosolen solmsi marchali: 105362029Help
Entry
105362029         CDS       T06056                                 

Definition
(RefSeq) biotin--protein ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol00780  Biotin metabolism
csol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    105362029
Enzymes [BR:csol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     105362029
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     105362029
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     105362029
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     105362029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_N
Motif
Other DBs
NCBI-GeneID: 105362029
NCBI-ProteinID: XP_011497656
Position
Unknown
AA seq 962 aa AA seqDB search
MFLTIFYMIATWMQSWRLSSLRARFQSILQDSETLKPSIMFYNPNKSLVKNGDANHVNIL
SSHLCCNSIDGKLGDLIWYQGNQQLYTIYPQQKVDVSDWLLFPRGKTIFPLFSHNNAQTS
LLQNAKIYLLIETELQYYQYGSVTATKLEDYGLIITWITDNNFGVILETDLDHITRFFTT
IMQGQLFINNGLYINRVACKYLMFTKNFLLYHLVTIIKIISCSQWPSYVNKLKQISQMAK
SMSQQLPEKINETRGMELILEDPASILELPKINESTLAETSENNVISTPMTNLSIMSTAV
NNTTDEELSQDSNHSINSTLLNSPGELPANSSHSELNKFPLQESLEENFTDIDITSRRHS
LPDNNEIGDNNEIGDNNAKRPNILICADSAIVNDNVCSVLRTTLKENKYAIYPLSMQDAQ
KDMWMEQTNLIIVCGNVEPDVASQVVEFIVRGGKLLALCSDILKIFIPAFKTAEIRENEL
VRFSYGKWKYVCLLHHIFCYQASPVKTKFSQDLEESNFSRPPASPIPVSTNICDQSGKKH
TFDLKILGSEETWHTPCILFANQLESGGQAVFSQIHLEVDPYQYEFEENKFTTLKDSNAT
RLEIFSDILSTHLGIEVDSQPKMNYTYSSGFFLGRHELKLEMMQRLKDILHPNDVLKTSK
LEIQFCNTSAITKPASSAFLPVFIHRCPENFSTVTYFENLNTKEIGRLVIYADVMTSSNY
VVNGLALHHGLAVIPYQQTKGQGRGDNVWLSPKGCAMFTLQLHIPIRSVLGDKISLIQYL
TSLAIITAVKLKPGYQDINMKIKWPNDIYTGNTKIGGILVTSFIQSSNIICNIGVGINLS
NTSPTTCINDIITKYNESSKLKLQQLPYEEFLARVFSEIESLLNIVQNGNLDHMYDQYYK
NWMHTNAEITVILPDNSSQKVKILGIDHYGFLEVKGTNGKKFTVHPDGNSFDILKGLVVP
KY
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaacaattttctatatgattgcaacttggatgcagtcatggaggttgtcatcc
ttaagagcacgtttccaatcaattttacaagattctgaaacattaaagccgtctataatg
ttttataatccaaataaatcattagttaaaaatggtgatgctaaccatgtcaatatatta
agctctcatttatgttgtaatagtattgatggaaaattgggagatcttatttggtaccaa
ggaaaccaacaattatatacaatatatcctcaacaaaaagtggacgtatcagactggttg
ttatttccacgtggaaaaactatatttccattattctctcataataatgcacaaacgtct
ctattacaaaatgccaaaatttatctgctcattgaaacagaattgcaatattatcaatat
ggatctgtgacagctacaaagcttgaagattacggtttaatcattacctggataactgac
aataattttggtgtaatacttgagacagatttggatcatattacaagattttttactaca
attatgcaaggacaactcttcataaataatggattgtatataaatcgtgtcgcatgtaaa
tatcttatgtttactaaaaattttcttctttatcatcttgtaacaattataaagataatt
agctgttcacaatggccttcgtatgttaataaattaaagcaaatcagtcaaatggcaaaa
tctatgtctcaacaacttccagaaaaaataaatgaaactcgtggtatggagttgatactg
gaagatccagcatcaattttggaattaccgaaaataaacgaaagtacattggcagaaaca
tcggagaataatgttataagcacaccaatgacaaatctttcaataatgtctactgccgta
aataataccacagatgaagaactctctcaagattcaaatcattccattaattcgacttta
ttgaattcgcctggagaattaccagctaactcgagtcattccgaattaaacaaatttcca
ttacaagagagtttggaagaaaattttacagatattgatatcacatctcgcaggcattcg
ttaccagataataacgagattggtgataataacgagattggtgataataatgccaaaaga
ccgaatattctgatatgcgccgacagtgcaattgtaaatgataatgtttgtagtgtgctc
cgaacaactttaaaagaaaataaatacgcaatctatccattatcaatgcaagatgcccaa
aaggacatgtggatggaacaaacaaatttgataattgtatgtggtaatgttgaaccggac
gttgcgtcgcaagtggtggagttcatcgttcgcggaggaaagcttttagctctttgttct
gatattttaaagattttcattccagcatttaaaactgcggaaatacgagagaacgaattg
gttcgtttttcatatggaaaatggaaatatgtgtgtctcctgcaccatattttttgctat
caagcatcgcccgtgaaaacaaaattttcccaagatttagaggaatcaaatttctctaga
ccaccagcatcgccaattccagtctcaacaaatatatgcgatcagtcaggcaagaaacac
actttcgacctaaagattcttggctcggaagaaacctggcatacgccctgtattctcttt
gcaaatcaattggaaagcggtggccaagccgtattctcccaaatccatttggaagttgat
ccttaccagtacgagtttgaggaaaataaatttacgacactcaaggacagcaacgcaaca
cgattagaaatattcagcgatattctcagtactcacctgggcattgaagttgattcgcag
ccaaagatgaactatacatatagttcgggattttttctgggaagacacgagctaaagttg
gaaatgatgcaacgattgaaggacatactccatccaaatgatgttttaaaaacatcgaaa
ttagagatacaattttgcaatacttccgcaattacaaaacctgcatcgtctgcttttctc
cctgtttttatacacagatgtccggagaatttttcaactgtaacatattttgagaatctc
aatactaaggaaattggacgtttggtcatttatgcggatgtcatgacatcatctaattac
gttgttaatggattggctttacatcatggcttagctgttataccataccaacaaactaaa
ggtcaaggacgaggtgataacgtgtggctgagcccaaaaggttgcgctatgtttacattg
caactccacattccaataagatctgtgctcggagataaaatatcacttatacaatattta
acaagtttagctataatcaccgccgtaaaattaaaaccaggttatcaggacatcaatatg
aagataaaatggcctaacgatatctataccggaaatactaaaattggtggaatacttgtt
acatcatttattcagtcgtccaatattatttgtaatataggagtgggcattaatctttct
aatacttcaccgacaacttgcattaacgatataattaccaagtacaacgagagttcaaaa
ttgaagttacagcagttgccatatgaagaatttctagctcgtgtatttagtgaaatagaa
agtttgctaaatattgtacaaaacggcaatcttgatcatatgtatgatcaatactacaaa
aattggatgcatacaaatgctgaaatcacagtgatacttccagataattcatcacagaaa
gtgaaaatattgggtattgaccattatggattcttagaagttaaaggaaccaacgggaag
aaatttacagtacatcccgatggaaatagctttgatattttaaagggcctcgtcgttcct
aaatattaa

DBGET integrated database retrieval system