KEGG   Ceratosolen solmsi marchali: 105363463Help
Entry
105363463         CDS       T06056                                 

Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol03013  RNA transport
Brite
KEGG Orthology (KO) [BR:csol00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105363463
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csol03016]
    105363463
   03036 Chromosome and associated proteins [BR:csol03036]
    105363463
Transfer RNA biogenesis [BR:csol03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    105363463
Chromosome and associated proteins [BR:csol03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     105363463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 105363463
NCBI-ProteinID: XP_011499457
Position
Unknown
AA seq 1215 aa AA seqDB search
MDFGVGNDITQISAELARVVEVMMSPNIPHQQRLEVYNACERFKESSPLCAQCGLFLAQK
SPDRSSIVRHFGLQLMEHCIKYRWTQISQSEKIFIKENAMKLLQEGMEPQVQEENHIKDA
LSRIVVEMIKREWPQQWPTLLAELSQTCTRGESQTELVLLVFLRLVEDVAILETLESNQR
RKDIYQALTTNMTEIFAFFLRLMEQHFAEFQKKNALGRPTEAAPNSRVVQVVLLTLSGFV
EWVSINHIMADKGRLLQILCLFLGDPTFGCPAAECLLQVVNRKGKAEDRKQLMILFTEEA
LRCIYAAATMLPPTGPSNLQEQHYLFLKKLTQVLNGMASQLCSLWSKDDIAGVRPAHFGL
FLDAVLTFTMHSSLTLVQLANTIWVMLFKHEHIKTDSLLLTYVPKYVENTAPKIVKVSFP
NKRLANGMSSYFVDYDTEEDFTVFFHRLRMDLLEGFRQATLVAPLVTFAYVQQWLTAKIR
KGSENLAYKSDPLDPEYLEWEALALTLDSIISRILLVSERPSVQNGLQLLELCLSYSPQD
AWLLSTVLSCISALFVFLSMSTGSMAMPGVAILPRVLEKIFAALVFNGPGETKENKSKAT
KNVRRHAASLMVKIGLKYPLLLLPVFDQIHTTVRGLLREPSQLSRMESLTLYEALLLISN
HFCDYERQTRFVAEVIGDTSTRLIAIGAEAFKGPIELMRFIGLDRPAVENGPDDSASVNR
SNLMFCINTILSVVKRCSIPEDPDRAARGGFVAAFSESGNPVYRNPATPHIMPVLPPLFT
LLRAMNALFLPTALSVLSEGYRNAYGLLESEKANLLCLNMANNSENAVEIDPQSAPLVRM
QSFITTIHDNCYHMLGSGCHTIGRDFYQLLGLATALLNSVFTNMEVIPDYRLRPIIRVFM
KPFIYSCPPAFYETVLVPVLAHVSTHMCQRLSANWQYITRLYESGSLDDENTDAQEVIDD
MLNRNLTREFVDVLKIALVGGAATDASPPDSMDQDSGGMAVDPPPTRGSNSIVAEVVSEL
GAFILRHPSTCHSVVLCILGALSWNDSNASLKSTMLTGPMVRALAADGSLTPAMAAHIMV
AILQGLQLHGQHEANQGSLITLGAQVYECLRPKFPNIIEVMQQIPGVNPADLQRFDEKMS
VVSTKGNKVEKGKKDLFKKITNQLIGRSIGQLFRKEVKIDNLPRLDIAGKQTLREDDISN
NDNDIALTRLFAGPT
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atggattttggggtaggtaacgatataactcaaatatcagcagagcttgctcgtgtggta
gaggtaatgatgtcacccaacatcccccatcagcagcgcttagaagtttacaatgcctgc
gaacgtttcaaggaatcttctcctttatgcgcacaatgtggcttatttcttgcacagaaa
tctccggacagaagttccattgtgaggcattttggcctccaattaatggaacactgcatt
aaatatcgatggacacaaatatcacagtcggagaaaatctttatcaaagaaaatgcaatg
aaacttctacaggaaggaatggaaccacaagtgcaagaagagaaccacattaaggatgct
ctatcgcgtatcgttgtggaaatgattaaacgagaatggccacaacagtggcctacccta
ctagcagaattaagtcaaacttgcacaagaggagaaagtcaaacggaacttgtacttttg
gtgttcctacgattagttgaggatgttgctattttggaaaccctggagtcgaatcagaga
cgaaaagacatttatcaagcattaacaacgaacatgacagaaatctttgctttctttttg
aggctaatggagcagcactttgctgaatttcaaaaaaaaaatgcacttggtaggccaacc
gaagcagcacctaacagcagagtagttcaggtggttcttttaacactctctggctttgtg
gaatgggtttcaataaatcacataatggcggataaaggtcgattgttacaaatactatgt
ttattcttgggggatccaacttttggttgtccagctgccgagtgcttattgcaagttgta
aatcgaaagggtaaagccgaggatagaaaacaattgatgatactttttacggaagaagcg
ttaagatgtatatatgctgctgcaacaatgctaccgccaaccggaccaagtaatttacaa
gaacaacattatttgttcttaaagaagttgactcaagtattgaatggcatggcaagtcag
ttatgttctctatggagcaaagacgatatagccggagtccgtccggcacattttggtctc
ttcctcgacgcggtactcaccttcaccatgcactctagccttactctcgttcaactagca
aatacaatttgggttatgctttttaaacacgagcacataaagaccgactcgcttcttttg
acttatgtgcctaaatatgtggaaaataccgcgcccaaaattgtcaaggtatccttccca
aacaaacgtctggcaaatggaatgagttcgtactttgtggattacgataccgaagaggat
tttacagtgttcttccatcgtctgcgaatggacctcctcgagggctttcgacaggcaacg
ctggtcgcccctctcgtgacctttgcctatgtgcaacagtggctcacggctaagatccgc
aagggctcggagaaccttgcctacaagagcgaccccctcgacccggagtacctcgagtgg
gaggccttagctctgacccttgactcgataatctcccgcattctgctagtgagcgagcgg
cccagcgtccaaaacggcttgcagctactcgagctgtgcttgagttactcgccccaggat
gcttggctgctctcgactgtgctgtcgtgcataagcgccctctttgtctttctgtcgatg
tcgacgggctcgatggcgatgcccggggttgccatactaccccgagtcctcgagaagatt
ttcgcggccctggtgtttaatgggcccggcgaaaccaaggaaaacaaatctaaagccacg
aaaaacgtgagacgacacgctgctagtcttatggtcaagatcggcctcaagtatccgcta
ctgcttttaccggttttcgaccaaatacacacgaccgtgaggggcttgctccgggagcct
agtcaactttcaaggatggaaagcttgacgctctacgaggcgctcctactaatttccaat
cacttttgcgattacgagaggcagacgagattcgtcgcggaggttataggcgacacctcg
acgagacttatcgcaattggcgcagaggcattcaagggtccgatcgaactcatgagattc
attgggcttgatagaccagccgttgaaaacggtcccgatgattcagcgagcgtcaatcga
tctaacctcatgttttgcatcaacacaatacttagcgtagtgaaaaggtgctcgataccg
gaggacccggaccgtgcggccaggggcggcttcgtcgctgcatttagcgaaagtggcaat
ccggtttatcgaaatccagcgacaccgcacattatgcccgtactaccgccacttttcact
ctcctcagggcaatgaacgcgctcttcttacccacagctttaagcgtcttgtccgagggg
tacagaaatgcatatgggctactagaatcggagaaagccaacttattgtgtttgaatatg
gcaaataatagcgaaaatgccgtagaaatagatccgcaatccgctcctctcgtcaggatg
caatcttttatcacaaccattcacgacaactgctatcacatgctcggtagtggatgccat
actatcggtcgagatttttatcaactactaggattagcaactgcattattaaattccgtt
tttacaaatatggaggtgattcctgactatagactgcgtccaattattcgcgtttttatg
aaaccttttatatactcgtgtccaccagctttttatgaaacggttcttgttcctgtacta
gcacatgtgtctactcacatgtgtcaaagactaagtgctaattggcaatatataactcga
ttgtacgagtctggtagtctcgatgacgaaaatacagatgctcaggaggtgatcgacgac
atgctcaacaggaatttaacgcgcgaattcgtagacgtattgaaaatagcactagttggc
ggagcggcgaccgatgcttcgcctcctgactcgatggatcaggacagcggtggtatggcc
gtcgatccacctccaaccaggggcagcaatagcatcgtcgcggaggttgtgagcgagctt
ggagcctttatacttaggcacccctccacatgtcacagcgtcgttttgtgcattctcggc
gcattatcgtggaatgattcgaacgcgagtctcaagtcgacaatgttgacgggtccaatg
gtgcgagccttagccgccgatggaagcttaacaccggcaatggcagcgcacataatggtc
gccatccttcaaggtcttcaactgcacggccagcacgaggcgaatcagggttcgctgata
acccttggtgctcaggtttatgaatgtctaaggcccaaattccccaatataatcgaagtt
atgcaacagatacctggtgtcaatccagccgacctgcagcgctttgatgaaaaaatgtcg
gtagtaagtaccaaaggtaacaaggtcgaaaagggaaagaaggacttgttcaagaaaatt
acaaatcagctgattggtagaagtattggtcaactatttcgcaaagaagtaaaaatcgac
aatctaccacggctggatattgcaggaaagcagacacttcgagaggacgatatatcaaat
aatgacaatgacatagcgttgacaagattattcgctggtcctacgtag

DBGET integrated database retrieval system