KEGG   Ceratosolen solmsi marchali: 105364688Help
Entry
105364688         CDS       T06056                                 

Definition
(RefSeq) probable pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol00790  Folate biosynthesis
csol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105364688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csol04147]
    105364688
Enzymes [BR:csol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     105364688
Exosome [BR:csol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105364688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 105364688
NCBI-ProteinID: XP_011500981
Position
Unknown
AA seq 135 aa AA seqDB search
MTAIFKKLGIEVFGRFSLFFYQTAEFQRTITVIKMTKLTEVERQKNLNPLLTNGWIVQKD
RDAIHKEFTFKNFNQAFGFMMRIAMQAEKMDHHPEWCNVYNRVNITLSTHDVNGLSMKDV
KLATFIDNILKSDNI
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatatttaaaaaattaggaatcgaagtattcggtcgattttccttatttttt
tatcagacagctgaatttcaacgaacaattactgtaataaaaatgaccaaattaacagaa
gttgaaaggcaaaaaaatttaaatccactacttactaatggttggattgttcaaaaggat
agagacgccattcataaagaatttacttttaaaaatttcaatcaggcatttggttttatg
atgcgaattgcaatgcaggctgagaaaatggatcatcaccccgaatggtgcaatgtatat
aatagagttaacataacattatcgactcatgatgtaaatggattatctatgaaagatgtc
aaacttgcaacttttattgataatattcttaaatctgacaacatataa

DBGET integrated database retrieval system